BLASTX nr result
ID: Angelica22_contig00046502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046502 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-19 ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-17 ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-17 ref|XP_002525536.1| pentatricopeptide repeat-containing protein,... 92 3e-17 ref|XP_002468625.1| hypothetical protein SORBIDRAFT_01g049260 [S... 89 5e-16 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 100 bits (249), Expect = 1e-19 Identities = 51/99 (51%), Positives = 71/99 (71%) Frame = +3 Query: 3 RIQTHVAFVKSYFNAGNCDKALKYVHDLDDQHLQSSNMLYSLVAYLHLKKGHLIIAQSIL 182 R+ TH AF+K YF++ ++A +YV D + SNM+YSL+A LH + G+LI AQ IL Sbjct: 473 RLTTHAAFIKGYFHSRRYEEAYEYVVDSGVTYKWPSNMIYSLLASLHQRNGNLISAQKIL 532 Query: 183 IQMMDKGLKPNFLVFIKVVKRLQKSCKGSLARDLRSRFS 299 I+M++KGLKPNF V+ +V++ L KS + LA DLRSRFS Sbjct: 533 IEMIEKGLKPNFSVYKRVLEHLDKSGREDLAGDLRSRFS 571 >ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|222862827|gb|EEF00334.1| predicted protein [Populus trichocarpa] Length = 432 Score = 93.6 bits (231), Expect = 1e-17 Identities = 47/98 (47%), Positives = 70/98 (71%) Frame = +3 Query: 3 RIQTHVAFVKSYFNAGNCDKALKYVHDLDDQHLQSSNMLYSLVAYLHLKKGHLIIAQSIL 182 R+ TH AF+K +FN+ ++A KYV D D ++ +S M YSL+A LH K+G+L+IAQ+IL Sbjct: 328 RLSTHAAFIKGFFNSEQYEEAYKYVVDSDKKYKCTSCMNYSLLARLHQKRGNLVIAQNIL 387 Query: 183 IQMMDKGLKPNFLVFIKVVKRLQKSCKGSLARDLRSRF 296 +M+ KGL+P F V++KV L KS + +LA DL+ +F Sbjct: 388 SEMIKKGLRPYFKVYMKVFNCLNKSGRETLATDLQEQF 425 >ref|XP_004141361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] gi|449498723|ref|XP_004160616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Cucumis sativus] Length = 494 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/103 (42%), Positives = 71/103 (68%) Frame = +3 Query: 3 RIQTHVAFVKSYFNAGNCDKALKYVHDLDDQHLQSSNMLYSLVAYLHLKKGHLIIAQSIL 182 R+ TH AFVKSYF++ ++A +Y D +++ + N YSL+A LH K+G+L+ AQ IL Sbjct: 385 RLSTHAAFVKSYFSSQRYEEAYQYAVDSSLKYVTTQNATYSLLATLHEKRGNLVDAQKIL 444 Query: 183 IQMMDKGLKPNFLVFIKVVKRLQKSCKGSLARDLRSRFSRFTV 311 ++MD GLKP+F V+ +++K+LQ +G LA DL+ + S ++ Sbjct: 445 SELMDAGLKPHFHVYTRLLKKLQVQGRGDLANDLKRKISNVSL 487 >ref|XP_002525536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535215|gb|EEF36894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 430 Score = 92.4 bits (228), Expect = 3e-17 Identities = 49/103 (47%), Positives = 71/103 (68%) Frame = +3 Query: 3 RIQTHVAFVKSYFNAGNCDKALKYVHDLDDQHLQSSNMLYSLVAYLHLKKGHLIIAQSIL 182 R+ TH AF+K +FN+ +KA KYV DD++ SSN+ YSL+A LH K+G+L+ A++IL Sbjct: 328 RLLTHAAFIKGFFNSQQYEKAYKYVVGSDDKY--SSNVNYSLLANLHQKQGNLVDAENIL 385 Query: 183 IQMMDKGLKPNFLVFIKVVKRLQKSCKGSLARDLRSRFSRFTV 311 +M+ KGL+P+F VF+KV K L KS LA L+ +F + V Sbjct: 386 SEMIKKGLRPHFNVFMKVKKHLMKSGNEELATSLQKKFLQLEV 428 >ref|XP_002468625.1| hypothetical protein SORBIDRAFT_01g049260 [Sorghum bicolor] gi|241922479|gb|EER95623.1| hypothetical protein SORBIDRAFT_01g049260 [Sorghum bicolor] Length = 422 Score = 88.6 bits (218), Expect = 5e-16 Identities = 45/103 (43%), Positives = 63/103 (61%) Frame = +3 Query: 3 RIQTHVAFVKSYFNAGNCDKALKYVHDLDDQHLQSSNMLYSLVAYLHLKKGHLIIAQSIL 182 RI H AF+K YF AG + A KYV+D+ + S N YSL+A L K G + A +L Sbjct: 314 RITIHSAFIKGYFYAGRIEDACKYVNDMSTRDRHSVNRNYSLLAKLLRKSGRTVDAGRVL 373 Query: 183 IQMMDKGLKPNFLVFIKVVKRLQKSCKGSLARDLRSRFSRFTV 311 ++MDKGL+P+ ++KV K L K +G LA +L+ F RF+V Sbjct: 374 YELMDKGLRPDHSAYVKVAKDLHKMGRGDLASELKMMFQRFSV 416