BLASTX nr result
ID: Angelica22_contig00046468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046468 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, p... 75 7e-12 ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, p... 72 5e-11 ref|XP_002522347.1| hypothetical protein RCOM_0602860 [Ricinus c... 70 2e-10 ref|XP_003635144.1| PREDICTED: polyneuridine-aldehyde esterase-l... 64 1e-08 >ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538430|gb|EEF40036.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Length = 260 Score = 74.7 bits (182), Expect = 7e-12 Identities = 30/49 (61%), Positives = 43/49 (87%) Frame = +2 Query: 23 LLLLEEIQRWMIESNPPDDVKVIKGSDHMIMFSKSQKLCICLEEISQQY 169 L++ E++QRWM+++NP D+VK+I GSDHM MFSK Q+LC CLEEI+++Y Sbjct: 211 LIIKEDMQRWMVKNNPTDEVKIIAGSDHMAMFSKPQELCACLEEIAKKY 259 >ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|222853663|gb|EEE91210.1| predicted protein [Populus trichocarpa] Length = 264 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +2 Query: 26 LLLEEIQRWMIESNPPDDVKVIKGSDHMIMFSKSQKLCICLEEISQQY 169 ++ E IQRWMIE NPPD+VKV+ GSDHM+MFSK Q++C CL E++ +Y Sbjct: 216 IIKEAIQRWMIEKNPPDEVKVVPGSDHMLMFSKPQEMCSCLLEVAGKY 263 >ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538427|gb|EEF40033.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Length = 250 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/45 (64%), Positives = 40/45 (88%) Frame = +2 Query: 35 EEIQRWMIESNPPDDVKVIKGSDHMIMFSKSQKLCICLEEISQQY 169 +++QRW+I +NPPD+VKVI SDHM+MFSK Q+LC CLEEI+++Y Sbjct: 205 QDLQRWVIRTNPPDEVKVIPDSDHMVMFSKPQELCSCLEEIAKKY 249 >ref|XP_002522347.1| hypothetical protein RCOM_0602860 [Ricinus communis] gi|223538425|gb|EEF40031.1| hypothetical protein RCOM_0602860 [Ricinus communis] Length = 118 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +2 Query: 35 EEIQRWMIESNPPDDVKVIKGSDHMIMFSKSQKLCICLEEISQQY 169 E++QRW+++SNPPD VK+I SDHM+MFSK Q+ C CLEEI+ +Y Sbjct: 43 EDLQRWVVQSNPPDWVKIIPDSDHMVMFSKPQEFCSCLEEIANKY 87 >ref|XP_003635144.1| PREDICTED: polyneuridine-aldehyde esterase-like [Vitis vinifera] Length = 261 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/48 (50%), Positives = 38/48 (79%) Frame = +2 Query: 26 LLLEEIQRWMIESNPPDDVKVIKGSDHMIMFSKSQKLCICLEEISQQY 169 ++ E+ QRW+I+ +PP +VK I G+DHM+M S+ ++LC+C +EI QQY Sbjct: 213 VMKEDFQRWVIDDSPPKEVKFIAGADHMVMMSRPKELCLCFQEIVQQY 260