BLASTX nr result
ID: Angelica22_contig00046459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046459 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330552.1| hypothetical protein POPTRDRAFT_270173 [Popu... 60 2e-07 ref|XP_002300565.1| hypothetical protein POPTRDRAFT_177484 [Popu... 56 3e-06 >ref|XP_002330552.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] gi|222872110|gb|EEF09241.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] Length = 916 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +3 Query: 51 QLSNLPESTCVKAVRVPCSCDKIVEPLLLNVCINLYYVDVIAQELGVTDA 200 Q S+ PES VKA+++P S DK V+P+ LN+ YY+DVIA++LGVTDA Sbjct: 201 QQSDSPESILVKAIQIPASLDKTVQPVTLNISSAGYYLDVIAEQLGVTDA 250 >ref|XP_002300565.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] gi|222847823|gb|EEE85370.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] Length = 926 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = +3 Query: 51 QLSNLPESTCVKAVRVPCSCDKIVEPLLLNVCINLYYVDVIAQELGVTDA 200 Q S PE+ VKA+++P S D+ ++P+ L++ + YY+DVIAQ+LGVTDA Sbjct: 213 QQSGSPENILVKAIQIPASLDETIQPVTLDISSSGYYLDVIAQKLGVTDA 262