BLASTX nr result
ID: Angelica22_contig00046258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046258 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601018.1| Sodium-coupled neutral amino acid transporte... 62 5e-08 ref|XP_003601017.1| Sodium-coupled neutral amino acid transporte... 62 5e-08 ref|XP_002876354.1| amino acid transporter family protein [Arabi... 62 5e-08 ref|XP_002520821.1| amino acid transporter, putative [Ricinus co... 60 2e-07 ref|XP_003545663.1| PREDICTED: putative sodium-coupled neutral a... 60 2e-07 >ref|XP_003601018.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355490066|gb|AES71269.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 586 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -2 Query: 418 RAATNEPLFPKLHPLESDTPRFVCLTCVVLVIAYLEPIVIPDIW*FFRFIGSTT 257 RA +E LFPK L +D RFV +T V+LV +YL I IPDIW FF+F+GSTT Sbjct: 477 RANIDELLFPKKPLLATDNKRFVIITLVLLVFSYLAAIAIPDIWYFFQFLGSTT 530 >ref|XP_003601017.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355490065|gb|AES71268.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 577 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -2 Query: 418 RAATNEPLFPKLHPLESDTPRFVCLTCVVLVIAYLEPIVIPDIW*FFRFIGSTT 257 RA +E LFPK L +D RFV +T V+LV +YL I IPDIW FF+F+GSTT Sbjct: 468 RANIDELLFPKKPLLATDNKRFVIITLVLLVFSYLAAIAIPDIWYFFQFLGSTT 521 >ref|XP_002876354.1| amino acid transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297322192|gb|EFH52613.1| amino acid transporter family protein [Arabidopsis lyrata subsp. lyrata] Length = 435 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = -2 Query: 418 RAATNEPLFPKLHPLESDTPRFVCLTCVVLVIAYLEPIVIPDIW*FFRFIGSTT 257 RA +E LFPK LE DT RF+ LT +L+ +L I +PDIW FF+F+GSTT Sbjct: 328 RANLDELLFPKKPSLEKDTKRFIGLTLALLICCFLSAITVPDIWYFFQFLGSTT 381 >ref|XP_002520821.1| amino acid transporter, putative [Ricinus communis] gi|223539952|gb|EEF41530.1| amino acid transporter, putative [Ricinus communis] Length = 440 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -2 Query: 418 RAATNEPLFPKLHPLESDTPRFVCLTCVVLVIAYLEPIVIPDIW*FFRFIGSTTM 254 RA +E LFPK L DT RFV LTC +L Y I IP+IW FF+F+GSTT+ Sbjct: 334 RANIDELLFPKRPILAMDTTRFVSLTCALLAATYTTAIAIPNIWYFFQFMGSTTI 388 >ref|XP_003545663.1| PREDICTED: putative sodium-coupled neutral amino acid transporter 10-like [Glycine max] Length = 443 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = -2 Query: 418 RAATNEPLFPKLH--PLESDTPRFVCLTCVVLVIAYLEPIVIPDIW*FFRFIGSTTMAHT 245 RA +E +F + PL SDTPRFV LT +L + YL + IP+IW FF+F+GSTT+ T Sbjct: 333 RANIDELIFSNKNKPPLASDTPRFVSLTLTLLALTYLVAVAIPNIWYFFQFLGSTTIVST 392