BLASTX nr result
ID: Angelica22_contig00046108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046108 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA88222.1| myb-related transcription factor LBM2 [Nicotiana... 111 5e-23 ref|XP_002524614.1| Transcription repressor MYB4, putative [Rici... 111 5e-23 emb|CBI23644.3| unnamed protein product [Vitis vinifera] 111 7e-23 ref|XP_002281274.1| PREDICTED: myb-related protein Myb4 [Vitis v... 111 7e-23 dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana... 110 9e-23 >dbj|BAA88222.1| myb-related transcription factor LBM2 [Nicotiana tabacum] Length = 277 Score = 111 bits (278), Expect = 5e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVRAPCCDKMGLKKGPWTPEEDQLLVSHVQQNGHANWRALPKQAGLLRCGKSCR 2 M RAPCC+KMGLKKGPWTPEEDQ+L+S +QQNGH NWRALPKQAGLLRCGKSCR Sbjct: 1 MGRAPCCEKMGLKKGPWTPEEDQILISFIQQNGHGNWRALPKQAGLLRCGKSCR 54 >ref|XP_002524614.1| Transcription repressor MYB4, putative [Ricinus communis] gi|223536167|gb|EEF37822.1| Transcription repressor MYB4, putative [Ricinus communis] Length = 302 Score = 111 bits (278), Expect = 5e-23 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVRAPCCDKMGLKKGPWTPEEDQLLVSHVQQNGHANWRALPKQAGLLRCGKSCR 2 MVRAPCC+KMGLKKGPWTPEEDQ+LV+++QQ GH NWRALPKQAGLLRCGKSCR Sbjct: 1 MVRAPCCEKMGLKKGPWTPEEDQILVNYIQQYGHGNWRALPKQAGLLRCGKSCR 54 >emb|CBI23644.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 111 bits (277), Expect = 7e-23 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVRAPCCDKMGLKKGPWTPEEDQLLVSHVQQNGHANWRALPKQAGLLRCGKSCR 2 M R+PCCDKMGLKKGPWTPEED++LV+HVQ++GH NWRALPKQAGLLRCGKSCR Sbjct: 1 MARSPCCDKMGLKKGPWTPEEDKILVAHVQKHGHGNWRALPKQAGLLRCGKSCR 54 >ref|XP_002281274.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera] Length = 267 Score = 111 bits (277), Expect = 7e-23 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVRAPCCDKMGLKKGPWTPEEDQLLVSHVQQNGHANWRALPKQAGLLRCGKSCR 2 M R+PCCDKMGLKKGPWTPEED++LV+HVQ++GH NWRALPKQAGLLRCGKSCR Sbjct: 1 MARSPCCDKMGLKKGPWTPEEDKILVAHVQKHGHGNWRALPKQAGLLRCGKSCR 54 >dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana tabacum] Length = 281 Score = 110 bits (276), Expect = 9e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVRAPCCDKMGLKKGPWTPEEDQLLVSHVQQNGHANWRALPKQAGLLRCGKSCR 2 MVRAPCC+KMGLKKGPWTPEEDQ+LVS++Q NGH NWRALPK AGLLRCGKSCR Sbjct: 1 MVRAPCCEKMGLKKGPWTPEEDQILVSYIQTNGHGNWRALPKLAGLLRCGKSCR 54