BLASTX nr result
ID: Angelica22_contig00046033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00046033 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279343.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_003628741.1| Pentatricopeptide repeat-containing protein ... 58 7e-07 ref|XP_003547890.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 >ref|XP_002279343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 623 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/70 (44%), Positives = 43/70 (61%) Frame = +3 Query: 45 IAPKPTLRLIEDKFSTFLQSCKXXXXXXXXXXXXVTQGIQFNDYIVPKFIGKCSELGIMS 224 +APKP RL+E++F + LQSCK + G Q+N+YI PK + C+ L M+ Sbjct: 28 LAPKPPHRLLEERFISLLQSCKTSKQVHQIQAQIIANGFQYNEYITPKLVTICATLKRMT 87 Query: 225 SARQLFDQMP 254 ARQLFDQ+P Sbjct: 88 YARQLFDQIP 97 >ref|XP_003628741.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522763|gb|AET03217.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 758 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/66 (39%), Positives = 38/66 (57%) Frame = +3 Query: 57 PTLRLIEDKFSTFLQSCKXXXXXXXXXXXXVTQGIQFNDYIVPKFIGKCSELGIMSSARQ 236 P R++E+KF T L+SCK VT G++ ND++ P FI CS + AR+ Sbjct: 6 PVQRIVEEKFITLLRSCKNYERLHQIQAQIVTHGLEHNDFVAPNFITTCSRFKRIHHARK 65 Query: 237 LFDQMP 254 LFD++P Sbjct: 66 LFDKIP 71 >ref|XP_003547890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 619 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/69 (37%), Positives = 39/69 (56%) Frame = +3 Query: 42 NIAPKPTLRLIEDKFSTFLQSCKXXXXXXXXXXXXVTQGIQFNDYIVPKFIGKCSELGIM 221 N KP R++EDKF + L++C VT G++ NDY+ P FI C+ LG + Sbjct: 11 NQTSKPLHRVVEDKFISLLRTCGTCVRLHQIQAQIVTHGLEGNDYVTPSFITACARLGGI 70 Query: 222 SSARQLFDQ 248 AR++FD+ Sbjct: 71 RRARRVFDK 79