BLASTX nr result
ID: Angelica22_contig00045849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045849 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus c... 55 5e-06 >ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus communis] gi|223524795|gb|EEF27713.1| hypothetical protein RCOM_2090500 [Ricinus communis] Length = 364 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/53 (52%), Positives = 32/53 (60%) Frame = +2 Query: 173 GLLVTPPXXXXXXXXXXXXXKQVVQWALEKFDREDNVLFKLLHIRPKITTVPT 331 GL PP K VV WALEKF ++NV+FKLLH+RPKIT VPT Sbjct: 14 GLPPIPPLTVGIAIDGKRKSKYVVYWALEKFIPKENVVFKLLHVRPKITAVPT 66