BLASTX nr result
ID: Angelica22_contig00045611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045611 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBK00919.1| POP1 protein [Arabidopsis thaliana] 83 3e-14 ref|NP_001078072.1| ribonuclease P [Arabidopsis thaliana] gi|330... 83 3e-14 gb|AAY82263.1| hypothetical protein At2g47290 [Arabidopsis thali... 83 3e-14 gb|AAB63829.1| hypothetical protein [Arabidopsis thaliana] 83 3e-14 ref|XP_002302780.1| predicted protein [Populus trichocarpa] gi|2... 82 4e-14 >emb|CBK00919.1| POP1 protein [Arabidopsis thaliana] Length = 307 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 5 EVGFGVSGDGTKRLRTHVWHAKRFTMSKIWGFYLPLGLHGR 127 E GF SGDGTKRLRTHVWHAKRFTM+K+WGF+LPLGLHGR Sbjct: 111 ETGFCTSGDGTKRLRTHVWHAKRFTMTKLWGFHLPLGLHGR 151 >ref|NP_001078072.1| ribonuclease P [Arabidopsis thaliana] gi|330255730|gb|AEC10824.1| ribonuclease P [Arabidopsis thaliana] Length = 826 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 5 EVGFGVSGDGTKRLRTHVWHAKRFTMSKIWGFYLPLGLHGR 127 E GF SGDGTKRLRTHVWHAKRFTM+K+WGF+LPLGLHGR Sbjct: 111 ETGFCTSGDGTKRLRTHVWHAKRFTMTKLWGFHLPLGLHGR 151 >gb|AAY82263.1| hypothetical protein At2g47290 [Arabidopsis thaliana] Length = 826 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 5 EVGFGVSGDGTKRLRTHVWHAKRFTMSKIWGFYLPLGLHGR 127 E GF SGDGTKRLRTHVWHAKRFTM+K+WGF+LPLGLHGR Sbjct: 111 ETGFCTSGDGTKRLRTHVWHAKRFTMTKLWGFHLPLGLHGR 151 >gb|AAB63829.1| hypothetical protein [Arabidopsis thaliana] Length = 190 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 5 EVGFGVSGDGTKRLRTHVWHAKRFTMSKIWGFYLPLGLHGR 127 E GF SGDGTKRLRTHVWHAKRFTM+K+WGF+LPLGLHGR Sbjct: 111 ETGFCTSGDGTKRLRTHVWHAKRFTMTKLWGFHLPLGLHGR 151 >ref|XP_002302780.1| predicted protein [Populus trichocarpa] gi|222844506|gb|EEE82053.1| predicted protein [Populus trichocarpa] Length = 169 Score = 82.0 bits (201), Expect = 4e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 5 EVGFGVSGDGTKRLRTHVWHAKRFTMSKIWGFYLPLGLHGR 127 E GF SGDGT+RLRTHVWHAKRFTM+K+WGF+LPLGLHGR Sbjct: 112 ESGFATSGDGTRRLRTHVWHAKRFTMTKLWGFHLPLGLHGR 152