BLASTX nr result
ID: Angelica22_contig00045513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045513 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173409.1| SHI-related sequence 7 protein [Arabidopsis tha... 60 1e-07 ref|XP_002893067.1| hypothetical protein ARALYDRAFT_472205 [Arab... 60 1e-07 gb|AAV68825.1| hypothetical protein AT1G19790 [Arabidopsis thali... 60 1e-07 gb|AAV68824.1| hypothetical protein AT1G19790 [Arabidopsis thali... 60 1e-07 ref|XP_002310281.1| short internodes 1 [Populus trichocarpa] gi|... 60 2e-07 >ref|NP_173409.1| SHI-related sequence 7 protein [Arabidopsis thaliana] gi|79318219|ref|NP_001031069.1| SHI-related sequence 7 protein [Arabidopsis thaliana] gi|10086492|gb|AAG12552.1|AC007797_12 Hypothetical Protein [Arabidopsis thaliana] gi|60547575|gb|AAX23751.1| hypothetical protein At1g19790 [Arabidopsis thaliana] gi|332191776|gb|AEE29897.1| SHI-related sequence 7 protein [Arabidopsis thaliana] gi|332191777|gb|AEE29898.1| SHI-related sequence 7 protein [Arabidopsis thaliana] Length = 345 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 147 INCEDCGNQAKKDXXXXXXXXXXXXXGFECQTHVKSTWVSASK 275 +NC+DCGNQAKKD GF+CQTHVKSTWVSA+K Sbjct: 117 MNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAK 159 >ref|XP_002893067.1| hypothetical protein ARALYDRAFT_472205 [Arabidopsis lyrata subsp. lyrata] gi|297338909|gb|EFH69326.1| hypothetical protein ARALYDRAFT_472205 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 147 INCEDCGNQAKKDXXXXXXXXXXXXXGFECQTHVKSTWVSASK 275 +NC+DCGNQAKKD GF+CQTHVKSTWVSA+K Sbjct: 118 MNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAK 160 >gb|AAV68825.1| hypothetical protein AT1G19790 [Arabidopsis thaliana] Length = 345 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 147 INCEDCGNQAKKDXXXXXXXXXXXXXGFECQTHVKSTWVSASK 275 +NC+DCGNQAKKD GF+CQTHVKSTWVSA+K Sbjct: 117 MNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAK 159 >gb|AAV68824.1| hypothetical protein AT1G19790 [Arabidopsis thaliana] Length = 234 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 147 INCEDCGNQAKKDXXXXXXXXXXXXXGFECQTHVKSTWVSASK 275 +NC+DCGNQAKKD GF+CQTHVKSTWVSA+K Sbjct: 117 MNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAK 159 >ref|XP_002310281.1| short internodes 1 [Populus trichocarpa] gi|222853184|gb|EEE90731.1| short internodes 1 [Populus trichocarpa] Length = 229 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = +3 Query: 147 INCEDCGNQAKKDXXXXXXXXXXXXXGFECQTHVKSTWVSASK 275 I+C+DCGNQAKKD GFECQTHVKSTWV ASK Sbjct: 119 ISCQDCGNQAKKDCIHMRCRTCCKSRGFECQTHVKSTWVPASK 161