BLASTX nr result
ID: Angelica22_contig00045432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045432 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75270.1| hypothetical protein VITISV_022685 [Vitis vinifera] 57 2e-06 gb|AAT39281.2| Integrase core domain containing protein [Solanum... 56 3e-06 >emb|CAN75270.1| hypothetical protein VITISV_022685 [Vitis vinifera] Length = 774 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/67 (38%), Positives = 38/67 (56%) Frame = -2 Query: 254 DPSTRAVLACGLNKSGLYEWSYVVSPHASTRSPIINSTTIPVSRWHQRLGHPNLKILKSM 75 D +TRA+L G K G+YEW + +S +S WH RLGHP+ I+K++ Sbjct: 203 DINTRAILLMGKPKDGVYEWPTTFPSVTPSSLLAFSSIKTTLSEWHSRLGHPSFTIMKNI 262 Query: 74 LHNFSLP 54 ++ FSLP Sbjct: 263 VYKFSLP 269 >gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum] Length = 1760 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/67 (44%), Positives = 38/67 (56%) Frame = -2 Query: 254 DPSTRAVLACGLNKSGLYEWSYVVSPHASTRSPIINSTTIPVSRWHQRLGHPNLKILKSM 75 D ST A L G N+ GLYEW + H +P N +P+ WH+RLGHPN + L + Sbjct: 403 DLSTGAPLFRGQNRDGLYEWPLGSAHH----TPQCN-VVVPLHLWHRRLGHPNHRTLNMI 457 Query: 74 LHNFSLP 54 H FSLP Sbjct: 458 FHQFSLP 464