BLASTX nr result
ID: Angelica22_contig00045259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045259 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001030955.1| survival of motor neuron-related-splicing fa... 73 3e-11 ref|NP_178361.2| survival of motor neuron-related-splicing facto... 73 3e-11 dbj|BAH56997.1| AT2G02570 [Arabidopsis thaliana] 73 3e-11 ref|XP_002876824.1| nucleic acid binding protein [Arabidopsis ly... 72 5e-11 ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-... 71 8e-11 >ref|NP_001030955.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|330250505|gb|AEC05599.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] Length = 288 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = -3 Query: 149 MQGGDDDLSIQQLSSNLSTYKQQLQQIRRLLHDDPRNSEYEDMEKELAE 3 M GG ++LSI+QL+S++STYK+QL+Q+R+LL +DPRNSEY DMEKEL E Sbjct: 1 MVGGVEELSIEQLASSISTYKEQLEQVRQLLSEDPRNSEYADMEKELKE 49 >ref|NP_178361.2| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|30678012|ref|NP_849927.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|145328250|ref|NP_001077871.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|27754612|gb|AAO22752.1| unknown protein [Arabidopsis thaliana] gi|28393903|gb|AAO42359.1| unknown protein [Arabidopsis thaliana] gi|330250503|gb|AEC05597.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|330250504|gb|AEC05598.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|330250506|gb|AEC05600.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] Length = 300 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = -3 Query: 149 MQGGDDDLSIQQLSSNLSTYKQQLQQIRRLLHDDPRNSEYEDMEKELAE 3 M GG ++LSI+QL+S++STYK+QL+Q+R+LL +DPRNSEY DMEKEL E Sbjct: 1 MVGGVEELSIEQLASSISTYKEQLEQVRQLLSEDPRNSEYADMEKELKE 49 >dbj|BAH56997.1| AT2G02570 [Arabidopsis thaliana] Length = 83 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = -3 Query: 149 MQGGDDDLSIQQLSSNLSTYKQQLQQIRRLLHDDPRNSEYEDMEKELAE 3 M GG ++LSI+QL+S++STYK+QL+Q+R+LL +DPRNSEY DMEKEL E Sbjct: 1 MVGGVEELSIEQLASSISTYKEQLEQVRQLLSEDPRNSEYADMEKELKE 49 >ref|XP_002876824.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297322662|gb|EFH53083.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 300 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = -3 Query: 149 MQGGDDDLSIQQLSSNLSTYKQQLQQIRRLLHDDPRNSEYEDMEKELAE 3 M+GG ++LSI+ L+SNLSTYK+QL+Q+R+LL +DPRN EY DMEKEL E Sbjct: 1 MEGGVEELSIEVLASNLSTYKEQLEQVRQLLSEDPRNLEYADMEKELKE 49 >ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-splicing factor 30-like [Vitis vinifera] Length = 301 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -3 Query: 149 MQGGDDDLSIQQLSSNLSTYKQQLQQIRRLLHDDPRNSEYEDMEKELAE 3 MQGG++ LSI +L+SNLSTYK QLQQ+R+LL DDP NSEY DMEKEL E Sbjct: 1 MQGGEE-LSIDELASNLSTYKDQLQQVRKLLVDDPGNSEYVDMEKELEE 48