BLASTX nr result
ID: Angelica22_contig00045177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045177 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-l... 87 1e-15 ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-l... 87 1e-15 ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-l... 86 2e-15 ref|XP_003593906.1| Exosome complex exonuclease RRP45 [Medicago ... 84 1e-14 ref|XP_003538065.1| PREDICTED: exosome complex component rrp45-l... 79 5e-13 >ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 454 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 158 MEQRLANTWRMTINERKFIQNCLLSELRVDGRRPFDYRRLTINFGREDGSS 310 MEQRLANTWR++ NE+KFI+ LLS+LRVDGR PFDYR LTINFG++DGSS Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSS 51 >ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 452 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 158 MEQRLANTWRMTINERKFIQNCLLSELRVDGRRPFDYRRLTINFGREDGSS 310 MEQRLANTWR++ NE+KFI+ LLS+LRVDGR PFDYR LTINFG++DGSS Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSS 51 >ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-like [Vitis vinifera] Length = 467 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/51 (74%), Positives = 48/51 (94%) Frame = +2 Query: 158 MEQRLANTWRMTINERKFIQNCLLSELRVDGRRPFDYRRLTINFGREDGSS 310 MEQRLA+T+RMT+NE+KFI+ LLS+LR+DGRRPFD+RR++I FGREDGSS Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRPFDFRRISIKFGREDGSS 51 >ref|XP_003593906.1| Exosome complex exonuclease RRP45 [Medicago truncatula] gi|355482954|gb|AES64157.1| Exosome complex exonuclease RRP45 [Medicago truncatula] Length = 449 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = +2 Query: 158 MEQRLANTWRMTINERKFIQNCLLSELRVDGRRPFDYRRLTINFGREDGSS 310 MEQRLAN WR+T+NE+KFI++ LLSELRVDGR P DYR+L I FGR+DGS+ Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSELRVDGRGPLDYRKLNIKFGRDDGSA 51 >ref|XP_003538065.1| PREDICTED: exosome complex component rrp45-like [Glycine max] Length = 438 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +2 Query: 158 MEQRLANTWRMTINERKFIQNCLLSELRVDGRRPFDYRRLTINFGREDGSS 310 MEQRLANTWRM +N++KFI+ LLS+LR+DGRRP DYR+LT+ ++DGS+ Sbjct: 1 MEQRLANTWRMPLNDKKFIETALLSDLRLDGRRPSDYRKLTVKLAKQDGSA 51