BLASTX nr result
ID: Angelica22_contig00045154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00045154 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512438.1| DNA binding protein, putative [Ricinus commu... 59 5e-07 >ref|XP_002512438.1| DNA binding protein, putative [Ricinus communis] gi|223548399|gb|EEF49890.1| DNA binding protein, putative [Ricinus communis] Length = 430 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 102 GDGCGKALPAVSCTICLDVVTEHGDRSCAKLQCG 1 G GCGK+ +VSC+ICLDVVT++GDRS AKLQCG Sbjct: 21 GGGCGKSFGSVSCSICLDVVTDNGDRSWAKLQCG 54