BLASTX nr result
ID: Angelica22_contig00044396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044396 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat... 56 4e-06 >ref|XP_003633275.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Vitis vinifera] Length = 572 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = +2 Query: 179 NVHNLDDALNLFDEMLQRKSNPPSVVAFTKLLGIITKTRHYDSAIVLYKKMCFLG 343 NV+ +DDAL+LF+ ML+ + PPS+V F+KLL IT+ +HY + + LYK+M G Sbjct: 31 NVNTIDDALSLFNRMLRMRP-PPSIVDFSKLLTSITRMKHYSTVLSLYKQMDSFG 84