BLASTX nr result
ID: Angelica22_contig00044199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044199 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_179555.1| cysteine/histidine-rich C1 domain-containing pr... 55 5e-06 ref|NP_187968.1| cysteine/histidine-rich C1 domain-containing pr... 55 6e-06 dbj|BAB02601.1| unnamed protein product [Arabidopsis thaliana] 55 6e-06 >ref|NP_179555.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|4191794|gb|AAD10163.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] gi|20466722|gb|AAM20678.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] gi|23397281|gb|AAN31922.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] gi|25084205|gb|AAN72195.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] gi|110741542|dbj|BAE98720.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] gi|330251814|gb|AEC06908.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 682 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/61 (37%), Positives = 32/61 (52%) Frame = +3 Query: 18 CAMSYPKIINHKWDSHSISLVYPPIYYKGFRYCEICELEVNQEAWLYRCIECDQCFHPLC 197 CA+ K++ H++D H + L Y + G +CE CE VN E W Y C EC H C Sbjct: 553 CAILPQKVMRHRYDDHPLFLSYGEMGVAGKYWCEACETTVNPEKWFYTCNECGITLHISC 612 Query: 198 I 200 + Sbjct: 613 V 613 >ref|NP_187968.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|332641858|gb|AEE75379.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 513 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Frame = +3 Query: 24 MSYPKIINHKWDSHSISLVYPPIYYKGFR---YCEICELEVNQEAWLYRCIECDQCFHPL 194 ++ PK++ +K+DSHS++L Y K F+ +CEICE +N++ Y C EC H Sbjct: 388 LNLPKLVKYKYDSHSLTLYSDKYYSKSFQLEWWCEICEENINKKKLFYTCHECCTTLHVE 447 Query: 195 CI-RQHHHVKLGSTVDPS 245 CI ++ ++K G + S Sbjct: 448 CILGKYPYLKSGHRIKVS 465 >dbj|BAB02601.1| unnamed protein product [Arabidopsis thaliana] Length = 486 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Frame = +3 Query: 24 MSYPKIINHKWDSHSISLVYPPIYYKGFR---YCEICELEVNQEAWLYRCIECDQCFHPL 194 ++ PK++ +K+DSHS++L Y K F+ +CEICE +N++ Y C EC H Sbjct: 361 LNLPKLVKYKYDSHSLTLYSDKYYSKSFQLEWWCEICEENINKKKLFYTCHECCTTLHVE 420 Query: 195 CI-RQHHHVKLGSTVDPS 245 CI ++ ++K G + S Sbjct: 421 CILGKYPYLKSGHRIKVS 438