BLASTX nr result
ID: Angelica22_contig00044185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044185 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006607888.1| movement protein [Soybean Putnam virus] gi|4... 67 2e-09 ref|YP_006907830.1| cell-to-cell transport protein [Horseradish ... 62 4e-08 emb|CAH59634.1| Movement protein [Carnation etched ring virus] g... 60 2e-07 emb|CAH59635.1| Movement protein [Carnation etched ring virus] 60 2e-07 gb|AEQ61914.1| movement protein [Carnation etched ring virus] 60 2e-07 >ref|YP_006607888.1| movement protein [Soybean Putnam virus] gi|401620156|gb|AFP95346.1| movement protein [Soybean Putnam virus] Length = 315 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 126 VVAYALTNSHHSIDYKKSEYIELEDVFSDIGSVEEKQFSEIS 1 VV YAL+NS HSIDYK EYIE++ VFSDIG VEEKQFS+IS Sbjct: 211 VVGYALSNSVHSIDYKHKEYIEIDQVFSDIGHVEEKQFSDIS 252 >ref|YP_006907830.1| cell-to-cell transport protein [Horseradish latent virus] gi|57790318|gb|AAW56085.1| cell-to-cell transport protein [Horseradish latent virus] Length = 320 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 135 IRAVVAYALTNSHHSIDYKKSEYIELEDVFSDIGSVEEKQF 13 I +VAYALTNSHHSIDYK S IELEDVF +IG+VE+ +F Sbjct: 216 ITYLVAYALTNSHHSIDYKSSSNIELEDVFQEIGNVEQSEF 256 >emb|CAH59634.1| Movement protein [Carnation etched ring virus] gi|55250905|emb|CAH68825.1| movement protein [Carnation etched ring virus] Length = 319 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 135 IRAVVAYALTNSHHSIDYKKSEYIELEDVFSDIGSVEEKQFSEI 4 I +VAYAL NSHHSIDYK+ + IE++DVFS+IGSV+ F+E+ Sbjct: 211 ITYLVAYALANSHHSIDYKEKDAIEIDDVFSEIGSVKSPTFTEL 254 >emb|CAH59635.1| Movement protein [Carnation etched ring virus] Length = 319 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 135 IRAVVAYALTNSHHSIDYKKSEYIELEDVFSDIGSVEEKQFSEI 4 I +VAYAL NSHHSIDYK+ + IE++DVFS+IGSV+ F+E+ Sbjct: 211 ITYLVAYALANSHHSIDYKEKDAIEIDDVFSEIGSVKSPTFTEL 254 >gb|AEQ61914.1| movement protein [Carnation etched ring virus] Length = 285 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 135 IRAVVAYALTNSHHSIDYKKSEYIELEDVFSDIGSVEEKQFSEI 4 I +VAYAL NSHHSIDYK+ + IE++DVFS+IGSV+ F+E+ Sbjct: 193 ITYLVAYALANSHHSIDYKEKDAIEIDDVFSEIGSVKSPTFTEL 236