BLASTX nr result
ID: Angelica22_contig00044122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044122 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002438450.1| hypothetical protein SORBIDRAFT_10g019990 [S... 55 5e-06 gb|EEC73151.1| hypothetical protein OsI_07183 [Oryza sativa Indi... 55 8e-06 >ref|XP_002438450.1| hypothetical protein SORBIDRAFT_10g019990 [Sorghum bicolor] gi|241916673|gb|EER89817.1| hypothetical protein SORBIDRAFT_10g019990 [Sorghum bicolor] Length = 298 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = +2 Query: 35 LPPPIVK*LRGRPKKQRRREGWDGRAPRGKLTKLTRLGRVMHCSNCHKVGHNRTKCP 205 L P VK + GRPK QRRRE G P+G TKL+R+G M CS C K GHN KCP Sbjct: 103 LAPAYVK-MPGRPKIQRRRE--QGEEPKG--TKLSRVGIKMRCSCCGKTGHNSRKCP 154 >gb|EEC73151.1| hypothetical protein OsI_07183 [Oryza sativa Indica Group] Length = 388 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = +2 Query: 11 EEVDGDEVLPPPIVK*LRGRPKKQRRREGWDGRAPRGKLTKLTRLGRVMHCSNCHKVGHN 190 E+++G +VLPP K + G+PKK RR+ + + G KLT+ G ++HCS CH+ HN Sbjct: 189 EKMNGPQVLPPAYEKKV-GKPKKTRRKHPTEVQGKNGP--KLTKHGVIIHCSYCHEPNHN 245 Query: 191 RTKCP 205 + CP Sbjct: 246 KKGCP 250