BLASTX nr result
ID: Angelica22_contig00044052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044052 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] 69 5e-10 ref|XP_002334116.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|ACX85638.1| putative transposase [Cucumis melo] 55 5e-06 >emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] Length = 563 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 121 SKRKPTRT-SDVWEHYTKVKGGDPENPRCTCNYCGADYACH 2 SKRKPT+ S+VW+H+TKVK DP PR TCNYCG DYACH Sbjct: 27 SKRKPTKPPSEVWDHFTKVKECDPNYPRATCNYCGIDYACH 67 >ref|XP_002334116.1| predicted protein [Populus trichocarpa] gi|222869650|gb|EEF06781.1| predicted protein [Populus trichocarpa] Length = 177 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 3/63 (4%) Frame = -1 Query: 181 DNANIQLKSP---KKEVNDKSPNSKRKPTRTSDVWEHYTKVKGGDPENPRCTCNYCGADY 11 D+ QL+ P K+ V+DK + S +W+H+TK+ G DP PR CNYCG DY Sbjct: 40 DSKGKQLQVPASRKRNVDDK---------KKSQIWDHFTKLDG-DPTTPRAECNYCGKDY 89 Query: 10 ACH 2 ACH Sbjct: 90 ACH 92 >gb|ACX85638.1| putative transposase [Cucumis melo] Length = 680 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -1 Query: 118 KRKPTRT-SDVWEHYTKVKGGDPENPRCTCNYCGADYAC 5 KRKP + S VWEH+ KV+G DP+ PR C +CGA YAC Sbjct: 21 KRKPVKPPSSVWEHFIKVEGCDPKYPRAACKHCGASYAC 59