BLASTX nr result
ID: Angelica22_contig00044022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00044022 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464793.1| hypothetical protein SORBIDRAFT_01g026820 [S... 58 9e-07 ref|XP_003623307.1| HAT family dimerization domain containing pr... 57 2e-06 ref|XP_003610296.1| HAT family dimerization domain containing pr... 56 3e-06 ref|XP_002443069.1| hypothetical protein SORBIDRAFT_08g007560 [S... 56 3e-06 >ref|XP_002464793.1| hypothetical protein SORBIDRAFT_01g026820 [Sorghum bicolor] gi|241918647|gb|EER91791.1| hypothetical protein SORBIDRAFT_01g026820 [Sorghum bicolor] Length = 650 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 4/83 (4%) Frame = +1 Query: 121 DAAPLWSNVTVIKAPQSGGGNRVWLCNYNNKQVTGSYTKVKGHLLHLKGFGVDPCNTIS- 297 D PLW +V ++ GGN V C + KQ++GSYT+++ HLL ++ GV C ++ Sbjct: 36 DKYPLWKHVNKVEKNGPDGGNAVIECKFCGKQISGSYTRIRAHLLKIQNQGVHICKKVTV 95 Query: 298 ---DQPREEMAREHQAAENLKSK 357 +Q R+E+ A N K K Sbjct: 96 PILEQLRKEVVDAEAAISNSKPK 118 >ref|XP_003623307.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355498322|gb|AES79525.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 175 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = +1 Query: 121 DAAPLWS--NVTVIKAPQSGGGNRVWLCNYNNKQVTGSYTKVKGHLLHLKGFGVDPCNT 291 D+ PLW +TV++ S GGN++W CN+ K+V SY++ + HLL + G GV C++ Sbjct: 42 DSKPLWRFVTITVVQNNDSAGGNKLWRCNFCQKEVRSSYSRARFHLLKIDGEGVQVCSS 100 >ref|XP_003610296.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355511351|gb|AES92493.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 153 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +1 Query: 121 DAAPLWS--NVTVIKAPQSGGGNRVWLCNYNNKQVTGSYTKVKGHLLHLKGFGVDPCNT 291 D+ PLW VTV++ S GGN++W CN+ K+V SY + + HLL + G GV C++ Sbjct: 20 DSKPLWRFVTVTVVQNNDSAGGNKLWRCNFCQKEVRSSYFRARFHLLKIAGEGVQVCSS 78 >ref|XP_002443069.1| hypothetical protein SORBIDRAFT_08g007560 [Sorghum bicolor] gi|241943762|gb|EES16907.1| hypothetical protein SORBIDRAFT_08g007560 [Sorghum bicolor] Length = 713 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 4/80 (5%) Frame = +1 Query: 130 PLWSNVTVIKAPQSGGGNRVWLCNYNNKQVTGSYTKVKGHLLHLKGFGVDPCNTISD--- 300 PLW++V +++ + GGN VW C Y + GSY+++K HLL + G G+ C + Sbjct: 21 PLWNHVVLLEKA-AAGGNAVWRCKYYKLEYKGSYSRIKSHLLRISGGGIKICTAVDKFIL 79 Query: 301 -QPREEMAREHQAAENLKSK 357 Q + E+A E K+K Sbjct: 80 AQLKSEVAEAADEIERSKAK 99