BLASTX nr result
ID: Angelica22_contig00043956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043956 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520375.1| hypothetical protein RCOM_1192800 [Ricinus c... 66 3e-09 ref|XP_002876478.1| hypothetical protein ARALYDRAFT_486331 [Arab... 65 4e-09 gb|AAV68865.1| hypothetical protein AT3G58770 [Arabidopsis thali... 64 1e-08 ref|NP_191436.1| uncharacterized protein [Arabidopsis thaliana] ... 64 1e-08 ref|XP_003633225.1| PREDICTED: uncharacterized protein LOC100854... 60 1e-07 >ref|XP_002520375.1| hypothetical protein RCOM_1192800 [Ricinus communis] gi|223540422|gb|EEF41991.1| hypothetical protein RCOM_1192800 [Ricinus communis] Length = 259 Score = 65.9 bits (159), Expect = 3e-09 Identities = 44/108 (40%), Positives = 52/108 (48%), Gaps = 34/108 (31%) Frame = -1 Query: 226 FSIREYTCQMRSVDVLKCWPF--GPTKMEYIEA-FLPPITVKKFKWWTDELD-------- 80 FSIREYT +MR VDV KCWPF G E +EA LPPITV KF+WW+ EL+ Sbjct: 9 FSIREYTEKMRVVDVEKCWPFSGGGGDKEQVEATLLPPITVTKFRWWSHELNKINQQKEQ 68 Query: 79 ---------------NELTE--------DLTCPVCFVFKAVSTQGLNA 5 NE E ++ CPVC F S + NA Sbjct: 69 GQGLEEDHCLIGVSRNEAKEKEEGEDELEIVCPVCGNFATESMEVFNA 116 >ref|XP_002876478.1| hypothetical protein ARALYDRAFT_486331 [Arabidopsis lyrata subsp. lyrata] gi|297322316|gb|EFH52737.1| hypothetical protein ARALYDRAFT_486331 [Arabidopsis lyrata subsp. lyrata] Length = 761 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 226 FSIREYTCQMRSVDVLKCWPFGPTKMEYIEAFLPPITVKKFKWWTDELDNELTE 65 FSIREYT ++RS +V KCWPF + ++FLPPITV KF+WW+ EL + LT+ Sbjct: 8 FSIREYTKKVRSENVRKCWPFAG---DLFQSFLPPITVSKFRWWSHELASLLTK 58 >gb|AAV68865.1| hypothetical protein AT3G58770 [Arabidopsis thaliana] Length = 771 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 226 FSIREYTCQMRSVDVLKCWPFGPTKMEYIEAFLPPITVKKFKWWTDELDNELTE 65 FSIREYT ++RS + KCWPF + I++FLPPITV KF+WW+ EL + LT+ Sbjct: 8 FSIREYTEKVRSDNERKCWPFAG---DLIQSFLPPITVSKFRWWSHELASLLTK 58 >ref|NP_191436.1| uncharacterized protein [Arabidopsis thaliana] gi|7630072|emb|CAB88294.1| putative protein [Arabidopsis thaliana] gi|332646307|gb|AEE79828.1| uncharacterized protein [Arabidopsis thaliana] Length = 771 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 226 FSIREYTCQMRSVDVLKCWPFGPTKMEYIEAFLPPITVKKFKWWTDELDNELTE 65 FSIREYT ++RS + KCWPF + I++FLPPITV KF+WW+ EL + LT+ Sbjct: 8 FSIREYTEKVRSDNERKCWPFAG---DLIQSFLPPITVSKFRWWSHELASLLTK 58 >ref|XP_003633225.1| PREDICTED: uncharacterized protein LOC100854859 [Vitis vinifera] Length = 238 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -1 Query: 232 ERFSIREYTCQMRSVDVLKCWPFGPTKMEYIEAFLPPITVKKFKWWTDELD 80 E FSIR+Y +MRSVDV+KCWPF LPP+ V KF+WW+ E++ Sbjct: 6 EGFSIRDYVWRMRSVDVVKCWPFDGDGHGDESVLLPPMEVPKFRWWSHEVE 56