BLASTX nr result
ID: Angelica22_contig00043850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043850 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. l... 88 8e-16 ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-15 gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thal... 86 2e-15 ref|NP_177865.2| pentatricopeptide repeat-containing protein [Ar... 86 2e-15 ref|XP_002520332.1| pentatricopeptide repeat-containing protein,... 78 6e-13 >ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333522|gb|EFH63940.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 459 Score = 87.8 bits (216), Expect = 8e-16 Identities = 45/82 (54%), Positives = 55/82 (67%) Frame = +1 Query: 1 IKNYPFDVTSNGATTCSDHPLSAQVVSEVLRLVPRLFFQSPRSVGCQKGFRHRAPLKQRN 180 I+N PFD +T + P + Q+VS+VLR +PR FF SPRS+G QKGFRHR+PLKQRN Sbjct: 20 IQNRPFDAVLASSTVAN--PWTQQLVSDVLRSIPRFFFISPRSIGRQKGFRHRSPLKQRN 77 Query: 181 LGEEMSRGSKGVRVLGPAGYRD 246 L +E R V VLGP Y D Sbjct: 78 LSDESQRRRSEVLVLGPGAYID 99 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] gi|449518241|ref|XP_004166151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] Length = 445 Score = 86.3 bits (212), Expect = 2e-15 Identities = 47/84 (55%), Positives = 56/84 (66%), Gaps = 2/84 (2%) Frame = +1 Query: 1 IKNYPFDV-TSNGATTCSDHPL-SAQVVSEVLRLVPRLFFQSPRSVGCQKGFRHRAPLKQ 174 +KN PFD + A+T + H L S+ VS+VLR VPR FFQS RS+G QKGFRHR PLKQ Sbjct: 23 LKNRPFDTHVHSAASTSTTHQLWSSDSVSDVLRSVPRFFFQSARSIGTQKGFRHRTPLKQ 82 Query: 175 RNLGEEMSRGSKGVRVLGPAGYRD 246 R L EE + V VLGP +RD Sbjct: 83 RKLKEEAYKFRNNVLVLGPGAHRD 106 >gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thaliana] Length = 410 Score = 86.3 bits (212), Expect = 2e-15 Identities = 44/82 (53%), Positives = 53/82 (64%) Frame = +1 Query: 1 IKNYPFDVTSNGATTCSDHPLSAQVVSEVLRLVPRLFFQSPRSVGCQKGFRHRAPLKQRN 180 I+N PFD +T P + Q+VS+VL +PR FF SPRS+G QKGFRHR+PLKQRN Sbjct: 20 IQNRPFDAVLASSTVAK--PWTQQLVSDVLHSIPRFFFISPRSIGRQKGFRHRSPLKQRN 77 Query: 181 LGEEMSRGSKGVRVLGPAGYRD 246 L +E R V VLGP Y D Sbjct: 78 LSDESQRRRSEVLVLGPGAYMD 99 >ref|NP_177865.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122244095|sp|Q1PFC5.1|PP130_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77405 gi|91806103|gb|ABE65780.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332197853|gb|AEE35974.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 458 Score = 86.3 bits (212), Expect = 2e-15 Identities = 44/82 (53%), Positives = 53/82 (64%) Frame = +1 Query: 1 IKNYPFDVTSNGATTCSDHPLSAQVVSEVLRLVPRLFFQSPRSVGCQKGFRHRAPLKQRN 180 I+N PFD +T P + Q+VS+VL +PR FF SPRS+G QKGFRHR+PLKQRN Sbjct: 20 IQNRPFDAVLASSTVAK--PWTQQLVSDVLHSIPRFFFISPRSIGRQKGFRHRSPLKQRN 77 Query: 181 LGEEMSRGSKGVRVLGPAGYRD 246 L +E R V VLGP Y D Sbjct: 78 LSDESQRRRSEVLVLGPGAYMD 99 >ref|XP_002520332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540551|gb|EEF42118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 441 Score = 78.2 bits (191), Expect = 6e-13 Identities = 40/82 (48%), Positives = 57/82 (69%) Frame = +1 Query: 1 IKNYPFDVTSNGATTCSDHPLSAQVVSEVLRLVPRLFFQSPRSVGCQKGFRHRAPLKQRN 180 I++ PFD+ +TT S LS+ ++S+VLR +PR FFQS RSVG Q RHR+PLKQR+ Sbjct: 19 IQHRPFDIQLASSTTTS--LLSSNLISDVLRSIPRFFFQSTRSVGRQSTTRHRSPLKQRS 76 Query: 181 LGEEMSRGSKGVRVLGPAGYRD 246 L +E + + + +LGPA Y+D Sbjct: 77 LKQETHKHNNKLLILGPAAYKD 98