BLASTX nr result
ID: Angelica22_contig00043665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043665 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA54615.1| 98.8kD polyprotein [Strawberry latent ringspot v... 107 1e-21 gb|ADN88404.1| polyprotein [Strawberry latent ringspot virus] 107 1e-21 gb|ADN88402.1| polyprotein [Strawberry latent ringspot virus] 107 1e-21 gb|ADN88406.1| polyprotein [Strawberry latent ringspot virus] 105 4e-21 ref|YP_227376.1| small coat protein [Strawberry latent ringspot ... 104 6e-21 >emb|CAA54615.1| 98.8kD polyprotein [Strawberry latent ringspot virus] Length = 890 Score = 107 bits (267), Expect = 1e-21 Identities = 47/77 (61%), Positives = 59/77 (76%) Frame = +3 Query: 12 KVPLGLRQKTFRLMTINKWAPSGFLYFPVTPSVHLPRTAGNFVADLEQQCPLMHRSQENC 191 ++PLGL QK FRL+TI+KW SGFL+FP TPS H+P+ AG F ++EQ PLMHRSQEN Sbjct: 650 RLPLGLLQKRFRLLTISKWPKSGFLFFPTTPSSHIPKLAGTFEGEVEQHSPLMHRSQENA 709 Query: 192 QWRGTLKYHLTARLEGA 242 QW G+L Y+L+ R GA Sbjct: 710 QWSGSLTYYLSIRYSGA 726 >gb|ADN88404.1| polyprotein [Strawberry latent ringspot virus] Length = 712 Score = 107 bits (266), Expect = 1e-21 Identities = 47/77 (61%), Positives = 60/77 (77%) Frame = +3 Query: 12 KVPLGLRQKTFRLMTINKWAPSGFLYFPVTPSVHLPRTAGNFVADLEQQCPLMHRSQENC 191 ++PLGL QK FRL+TI+KW SGFL+FP+TPS H+P+ AG F ++EQ PLMHRSQEN Sbjct: 496 RLPLGLLQKKFRLLTISKWPKSGFLFFPMTPSSHMPKLAGTFEGEVEQHSPLMHRSQENA 555 Query: 192 QWRGTLKYHLTARLEGA 242 QW G+L Y+L+ R GA Sbjct: 556 QWCGSLTYYLSIRYSGA 572 >gb|ADN88402.1| polyprotein [Strawberry latent ringspot virus] Length = 712 Score = 107 bits (266), Expect = 1e-21 Identities = 47/77 (61%), Positives = 60/77 (77%) Frame = +3 Query: 12 KVPLGLRQKTFRLMTINKWAPSGFLYFPVTPSVHLPRTAGNFVADLEQQCPLMHRSQENC 191 ++PLGL QK FRL+TI+KW SGFL+FP+TPS H+P+ AG F ++EQ PLMHRSQEN Sbjct: 496 RLPLGLLQKKFRLLTISKWPKSGFLFFPMTPSSHMPKLAGTFEGEVEQHSPLMHRSQENA 555 Query: 192 QWRGTLKYHLTARLEGA 242 QW G+L Y+L+ R GA Sbjct: 556 QWCGSLTYYLSIRYSGA 572 >gb|ADN88406.1| polyprotein [Strawberry latent ringspot virus] Length = 712 Score = 105 bits (262), Expect = 4e-21 Identities = 46/77 (59%), Positives = 59/77 (76%) Frame = +3 Query: 12 KVPLGLRQKTFRLMTINKWAPSGFLYFPVTPSVHLPRTAGNFVADLEQQCPLMHRSQENC 191 ++PLGL QK FRL+TI+KW SGFL+FP+TPS H+P+ G F ++EQ PLMHRSQEN Sbjct: 496 RLPLGLLQKKFRLLTISKWPKSGFLFFPMTPSSHMPKLVGTFEGEVEQHSPLMHRSQENA 555 Query: 192 QWRGTLKYHLTARLEGA 242 QW G+L Y+L+ R GA Sbjct: 556 QWCGSLTYYLSIRYSGA 572 >ref|YP_227376.1| small coat protein [Strawberry latent ringspot virus] Length = 235 Score = 104 bits (260), Expect = 6e-21 Identities = 45/77 (58%), Positives = 58/77 (75%) Frame = +3 Query: 12 KVPLGLRQKTFRLMTINKWAPSGFLYFPVTPSVHLPRTAGNFVADLEQQCPLMHRSQENC 191 ++PLGL Q+ FRL+TI+KW SGFL+FP TPS H+P+ G F ++EQ PLMHRSQEN Sbjct: 19 RLPLGLLQRRFRLLTISKWPKSGFLFFPTTPSSHIPKLVGTFEGEVEQHSPLMHRSQENA 78 Query: 192 QWRGTLKYHLTARLEGA 242 QW G+L Y+L+ R GA Sbjct: 79 QWSGSLTYYLSIRYSGA 95