BLASTX nr result
ID: Angelica22_contig00043621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043621 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518999.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002518999.1| conserved hypothetical protein [Ricinus communis] gi|223541986|gb|EEF43532.1| conserved hypothetical protein [Ricinus communis] Length = 651 Score = 55.5 bits (132), Expect = 5e-06 Identities = 46/134 (34%), Positives = 60/134 (44%), Gaps = 16/134 (11%) Frame = +1 Query: 67 ELWTDDLLHQLIEVEEQL--TQQRHXXXXXXXXXXXXXXXQKFNDKP--LKHYDH---FS 225 E W D L QLI+VEE + + F+ +P +HY H FS Sbjct: 7 EEWDADFLDQLIQVEELALSSSSTNPLLIPSQPTTTATAATTFSIQPPQQQHYHHNTCFS 66 Query: 226 NAPSISRTSDATVSSLINHNNGIVAVDA---------KQQEIDRLKSELGRASKHVIHLE 378 +P R N+NNG+ K QEIDRLK ELG SK + LE Sbjct: 67 YSPP--RELSQKPIDFHNNNNGLSFFTPPFSLPQQTHKDQEIDRLKRELGTVSKKLSDLE 124 Query: 379 KECLDLKKERDKKE 420 +ECL L+ ER++KE Sbjct: 125 QECLQLRNERNRKE 138