BLASTX nr result
ID: Angelica22_contig00043612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043612 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629742.1| Pentatricopeptide repeat-containing protein ... 102 3e-20 ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-19 ref|XP_002327681.1| predicted protein [Populus trichocarpa] gi|2... 98 8e-19 ref|XP_004169636.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 >ref|XP_003629742.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523764|gb|AET04218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 102 bits (254), Expect = 3e-20 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +1 Query: 7 SGSSITIVKNLRICEDCHLFMCGASWVTGRKIIIRDNMRFHHFHDGACSCNNFW 168 +GS+I I+KNLRICEDCH+ MCGAS +TGRKII+RDNMRFHHF +GACSCNNFW Sbjct: 563 AGSTIKIMKNLRICEDCHIVMCGASKLTGRKIIVRDNMRFHHFLNGACSCNNFW 616 >ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Glycine max] Length = 617 Score = 98.6 bits (244), Expect = 5e-19 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +1 Query: 10 GSSITIVKNLRICEDCHLFMCGASWVTGRKIIIRDNMRFHHFHDGACSCNNFW 168 GS+I I+KNLRICEDCH+ MCGAS VTGRKI++RDN RFHHF +GACSC+NFW Sbjct: 565 GSTIKIMKNLRICEDCHIVMCGASKVTGRKIVVRDNTRFHHFLNGACSCSNFW 617 >ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Vitis vinifera] Length = 647 Score = 98.2 bits (243), Expect = 6e-19 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = +1 Query: 7 SGSSITIVKNLRICEDCHLFMCGASWVTGRKIIIRDNMRFHHFHDGACSCNNFW 168 +G +I IVKNLRICEDCH MCGAS +TGR+I++RDNMRFHHF DG CSC NFW Sbjct: 594 AGCTIRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGRCSCGNFW 647 >ref|XP_002327681.1| predicted protein [Populus trichocarpa] gi|222836766|gb|EEE75159.1| predicted protein [Populus trichocarpa] Length = 654 Score = 97.8 bits (242), Expect = 8e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +1 Query: 10 GSSITIVKNLRICEDCHLFMCGASWVTGRKIIIRDNMRFHHFHDGACSCNNFW 168 GS I IVKNLRICEDCH +CGAS +TGR+II+RD MRFHHFHDG CSC NFW Sbjct: 602 GSKIRIVKNLRICEDCHSVICGASQITGREIIVRDIMRFHHFHDGICSCGNFW 654 >ref|XP_004169636.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Cucumis sativus] Length = 650 Score = 95.5 bits (236), Expect = 4e-18 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +1 Query: 7 SGSSITIVKNLRICEDCHLFMCGASWVTGRKIIIRDNMRFHHFHDGACSCNNFW 168 +G +I I+KN+RICEDCH MC AS +TGR+II+RDNMRFHHFH+G CSC NFW Sbjct: 597 AGDTIKIMKNIRICEDCHNVMCAASEITGREIIVRDNMRFHHFHNGTCSCGNFW 650