BLASTX nr result
ID: Angelica22_contig00043570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043570 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arab... 62 5e-08 ref|XP_003519187.1| PREDICTED: purine permease 3-like [Glycine max] 61 8e-08 ref|XP_003602860.1| Purine permease [Medicago truncatula] gi|355... 61 8e-08 ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vin... 61 8e-08 gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana] 61 1e-07 >ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. lyrata] gi|297339355|gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. lyrata] Length = 356 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 277 AEKGVALVLSLWGFVSYFYGEVKQSKKMEKKRRAAETELPL 155 AEKGV+L+LSLWGFVSYFYGE+K KK+ K + ETELP+ Sbjct: 308 AEKGVSLLLSLWGFVSYFYGEIKSGKKVLDKPQPPETELPI 348 >ref|XP_003519187.1| PREDICTED: purine permease 3-like [Glycine max] Length = 344 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 277 AEKGVALVLSLWGFVSYFYGEVKQSKKMEKKRRAAETELP 158 AEKGVALVLSLWGFVSYFYGE+KQ ++ + K R ET+LP Sbjct: 299 AEKGVALVLSLWGFVSYFYGEIKQDRE-KNKNRCPETDLP 337 >ref|XP_003602860.1| Purine permease [Medicago truncatula] gi|355491908|gb|AES73111.1| Purine permease [Medicago truncatula] Length = 440 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/66 (51%), Positives = 46/66 (69%) Frame = -3 Query: 277 AEKGVALVLSLWGFVSYFYGEVKQSKKMEKKRRAAETELPLNQIVAS*TCSVLRKMNVLL 98 AEKGV+LVLSLWGFVSYFYGE+K + K EKK+R+ E E + Q + ++LR N+ Sbjct: 324 AEKGVSLVLSLWGFVSYFYGEIKHA-KAEKKKRSLEIE--MGQTIEGLPKNILR--NIYF 378 Query: 97 LTVIGK 80 L +G+ Sbjct: 379 LICVGR 384 >ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vinifera] Length = 351 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 277 AEKGVALVLSLWGFVSYFYGEVKQSKKMEKKRRAAETELP 158 AEKGV+L LSLWGFVSYFYGE+K SKK KK +ETELP Sbjct: 309 AEKGVSLALSLWGFVSYFYGEIKDSKK--KKNPTSETELP 346 >gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana] Length = 356 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 277 AEKGVALVLSLWGFVSYFYGEVKQSKKMEKKRRAAETELPL 155 AEKGV+L+LSLWGFVSYFYGE K KK+ K + ETELP+ Sbjct: 308 AEKGVSLLLSLWGFVSYFYGEFKSGKKVVDKPQPPETELPI 348