BLASTX nr result
ID: Angelica22_contig00043522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043522 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887150.1| hypothetical protein ARALYDRAFT_475894 [Arab... 76 3e-12 ref|NP_001117565.1| RING/U-box domain-containing protein [Arabid... 74 1e-11 ref|XP_003631250.1| PREDICTED: E3 ubiquitin-protein ligase AIP2-... 70 1e-10 gb|AAF97967.1|AC000103_17 F21J9.24 [Arabidopsis thaliana] 70 2e-10 ref|NP_973908.1| RING/U-box domain-containing protein [Arabidops... 70 2e-10 >ref|XP_002887150.1| hypothetical protein ARALYDRAFT_475894 [Arabidopsis lyrata subsp. lyrata] gi|297332991|gb|EFH63409.1| hypothetical protein ARALYDRAFT_475894 [Arabidopsis lyrata subsp. lyrata] Length = 132 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 4/76 (5%) Frame = -1 Query: 218 EDEDTYNEPSSPRRVFTSKYGSM----MWEKRVTMEECCCVCLCRFKEDEDVSELCYCQH 51 ED+ + + RR+ + +GS +R ME CCVCLC FKE+E+VSEL C+H Sbjct: 50 EDDQAHEDSKRRRRISVTHFGSAENRGSKHEREAME--CCVCLCGFKEEEEVSELVSCKH 107 Query: 50 LFHKVCLEKWFDNQHT 3 FH CL+KWF N HT Sbjct: 108 YFHTACLDKWFSNDHT 123 >ref|NP_001117565.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332196588|gb|AEE34709.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 133 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 4/79 (5%) Frame = -1 Query: 227 ADTEDEDTYNEPSSPRRVFTSKYGSMMWEKRVTMEEC----CCVCLCRFKEDEDVSELCY 60 A +++D +E S RR + + + E R + E CCVCLC FKE+E+VSEL Sbjct: 46 ARNKEDDQDHEDSKRRRRISITHFESLCENRGSRNEREAMDCCVCLCGFKEEEEVSELVS 105 Query: 59 CQHLFHKVCLEKWFDNQHT 3 C+H FH CL+KWF N HT Sbjct: 106 CKHYFHSACLDKWFGNNHT 124 >ref|XP_003631250.1| PREDICTED: E3 ubiquitin-protein ligase AIP2-like [Vitis vinifera] gi|296081356|emb|CBI16789.3| unnamed protein product [Vitis vinifera] Length = 138 Score = 70.5 bits (171), Expect = 1e-10 Identities = 37/82 (45%), Positives = 48/82 (58%), Gaps = 11/82 (13%) Frame = -1 Query: 215 DEDTYNEPSSP-------RRVFTSKYGSMMWEKRVTMEEC----CCVCLCRFKEDEDVSE 69 +ED NE SP RRV +++ S+ C CCVCLCRF+ +E+VSE Sbjct: 49 EEDPSNEEYSPMSENAKERRVSVTQFKSLSHSSGTGTGWCSSMDCCVCLCRFEAEEEVSE 108 Query: 68 LCYCQHLFHKVCLEKWFDNQHT 3 L C+H FHK C EKWFDN+H+ Sbjct: 109 LS-CKHFFHKGCWEKWFDNKHS 129 >gb|AAF97967.1|AC000103_17 F21J9.24 [Arabidopsis thaliana] Length = 131 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = -1 Query: 224 DTEDEDTYNEPSSPRRVFTSKYGSMMWEKRVTMEEC---CCVCLCRFKEDEDVSELCYCQ 54 D E ED + RR+ +++ S+ EE CCVCLC FKE+E+VSEL C+ Sbjct: 50 DDEPEDDF----VTRRISITQFKSLCENIEEEEEEKGVECCVCLCGFKEEEEVSELVSCK 105 Query: 53 HLFHKVCLEKWFDNQHT 3 H FH+ CL+ WF N HT Sbjct: 106 HFFHRACLDNWFGNNHT 122 >ref|NP_973908.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|48958501|gb|AAT47803.1| At1g24580 [Arabidopsis thaliana] gi|58652104|gb|AAW80877.1| At1g24580 [Arabidopsis thaliana] gi|332192427|gb|AEE30548.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 113 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = -1 Query: 224 DTEDEDTYNEPSSPRRVFTSKYGSMMWEKRVTMEEC---CCVCLCRFKEDEDVSELCYCQ 54 D E ED + RR+ +++ S+ EE CCVCLC FKE+E+VSEL C+ Sbjct: 32 DDEPEDDF----VTRRISITQFKSLCENIEEEEEEKGVECCVCLCGFKEEEEVSELVSCK 87 Query: 53 HLFHKVCLEKWFDNQHT 3 H FH+ CL+ WF N HT Sbjct: 88 HFFHRACLDNWFGNNHT 104