BLASTX nr result
ID: Angelica22_contig00043363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00043363 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268607.1| PREDICTED: protein CHUP1, chloroplastic-like... 91 1e-16 emb|CBI31084.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002533785.1| actin binding protein, putative [Ricinus com... 77 1e-12 gb|AFW74457.1| hypothetical protein ZEAMMB73_017004 [Zea mays] 76 2e-12 gb|EAZ05478.1| hypothetical protein OsI_27693 [Oryza sativa Indi... 74 1e-11 >ref|XP_002268607.1| PREDICTED: protein CHUP1, chloroplastic-like [Vitis vinifera] Length = 801 Score = 90.9 bits (224), Expect = 1e-16 Identities = 52/83 (62%), Positives = 61/83 (73%), Gaps = 1/83 (1%) Frame = -2 Query: 247 DHLRGWLQESKEREIHLQAQLLDCKRSPKILDLERELELKKIENDNLLRKVAHLESENTS 68 DHLR LQESKERE LQA+LL+ KR+P+ILDLERELE+KK E + L +KV LESE TS Sbjct: 121 DHLRSLLQESKEREFKLQAELLEFKRNPEILDLERELEVKKSEVNELSQKVRLLESEKTS 180 Query: 67 LSEQLVSATSTLEER-HIWKREN 2 LSEQL S E R + KRE+ Sbjct: 181 LSEQLSGLASIAERREELLKRED 203 >emb|CBI31084.3| unnamed protein product [Vitis vinifera] Length = 781 Score = 90.9 bits (224), Expect = 1e-16 Identities = 52/83 (62%), Positives = 61/83 (73%), Gaps = 1/83 (1%) Frame = -2 Query: 247 DHLRGWLQESKEREIHLQAQLLDCKRSPKILDLERELELKKIENDNLLRKVAHLESENTS 68 DHLR LQESKERE LQA+LL+ KR+P+ILDLERELE+KK E + L +KV LESE TS Sbjct: 121 DHLRSLLQESKEREFKLQAELLEFKRNPEILDLERELEVKKSEVNELSQKVRLLESEKTS 180 Query: 67 LSEQLVSATSTLEER-HIWKREN 2 LSEQL S E R + KRE+ Sbjct: 181 LSEQLSGLASIAERREELLKRED 203 >ref|XP_002533785.1| actin binding protein, putative [Ricinus communis] gi|223526286|gb|EEF28598.1| actin binding protein, putative [Ricinus communis] Length = 791 Score = 77.4 bits (189), Expect = 1e-12 Identities = 42/83 (50%), Positives = 57/83 (68%), Gaps = 2/83 (2%) Frame = -2 Query: 247 DHLRGWLQESKEREIHLQAQLLDCKRSPKILDLERELELKKIENDNLLRKVAHLESENTS 68 DHLR LQESKERE LQA++ + KR+ ++L+LEREL +KK E D LL+++ LESE T Sbjct: 134 DHLRSLLQESKEREFKLQAEVSELKRNGRLLELERELAVKKNEVDELLQRIGILESEKTV 193 Query: 67 LSEQLVSATSTLEERH--IWKRE 5 L EQ+ E++H + KRE Sbjct: 194 LCEQVAEMCLNSEKKHEEVLKRE 216 >gb|AFW74457.1| hypothetical protein ZEAMMB73_017004 [Zea mays] Length = 933 Score = 76.3 bits (186), Expect = 2e-12 Identities = 40/76 (52%), Positives = 55/76 (72%) Frame = -2 Query: 247 DHLRGWLQESKEREIHLQAQLLDCKRSPKILDLERELELKKIENDNLLRKVAHLESENTS 68 DHLR L+ESKERE+ LQ++L C+ +PK+ +LE+EL+ + E D L R LE+E TS Sbjct: 257 DHLREQLRESKERELTLQSELRQCRENPKVSELEKELDSMRDEVDRLARLKISLEAEKTS 316 Query: 67 LSEQLVSATSTLEERH 20 +SEQL SA S++EE H Sbjct: 317 ISEQL-SALSSMEEHH 331 >gb|EAZ05478.1| hypothetical protein OsI_27693 [Oryza sativa Indica Group] Length = 809 Score = 73.9 bits (180), Expect = 1e-11 Identities = 39/76 (51%), Positives = 55/76 (72%) Frame = -2 Query: 247 DHLRGWLQESKEREIHLQAQLLDCKRSPKILDLERELELKKIENDNLLRKVAHLESENTS 68 DHLR L+ESKERE+ LQ++L C+ +P++ +LE++L+ +K E D L+R LE E TS Sbjct: 132 DHLREQLRESKERELALQSELRQCRENPRVSELEKDLDSRKNEIDRLVRLKTSLEVEKTS 191 Query: 67 LSEQLVSATSTLEERH 20 LSEQL SA S + E+H Sbjct: 192 LSEQL-SALSCMVEQH 206