BLASTX nr result
ID: Angelica22_contig00042876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00042876 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192852.1| ethylene-responsive transcription factor CRF1 [... 55 6e-06 >ref|NP_192852.1| ethylene-responsive transcription factor CRF1 [Arabidopsis thaliana] gi|75220260|sp|O82503.1|CRF1_ARATH RecName: Full=Ethylene-responsive transcription factor CRF1; AltName: Full=Protein CYTOKININ RESPONSE FACTOR 1 gi|3600050|gb|AAC35537.1| contains similarity to AP2 domain containing proteins [Arabidopsis thaliana] gi|4850293|emb|CAB43049.1| putative Ap2 domain protein [Arabidopsis thaliana] gi|7267813|emb|CAB81215.1| putative Ap2 domain protein [Arabidopsis thaliana] gi|48479290|gb|AAT44916.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana] gi|92856649|gb|ABE77414.1| At4g11140 [Arabidopsis thaliana] gi|332657577|gb|AEE82977.1| ethylene-responsive transcription factor CRF1 [Arabidopsis thaliana] Length = 287 Score = 55.1 bits (131), Expect = 6e-06 Identities = 40/117 (34%), Positives = 58/117 (49%) Frame = -3 Query: 387 SAESTRLSRDDSTQSVMVGVNEEVIDSAPLVKKEVNNDNFVFGSDPMSDDPYLKDDPFCD 208 S EST + + VGV+ I +VKKE + + F + SDD F Sbjct: 184 SGESTAVKEE------FVGVSTAEI----VVKKEPSFNGSDFSAPLFSDDDVFG---FST 230 Query: 207 TVSDIFGPAGFSMFGFEEEKNGLFFGSSCDYGLTSWPTEDYFQDFGDVFGSDPLVSL 37 ++S+ FG F F + G FG G +SW ED+FQD GD+FGSDP++++ Sbjct: 231 SMSESFGGDLFGDNLFADMSFGSGFGFGSGSGFSSWHVEDHFQDIGDLFGSDPVLTV 287