BLASTX nr result
ID: Angelica22_contig00041862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041862 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510986.1| conserved hypothetical protein [Ricinus comm... 54 1e-05 >ref|XP_002510986.1| conserved hypothetical protein [Ricinus communis] gi|223550101|gb|EEF51588.1| conserved hypothetical protein [Ricinus communis] Length = 852 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +2 Query: 98 SGFRICKPQGTFLWPNMAPNNGSSPVLVQVEDLFMVHTP 214 SGFRICKPQGTFLWPN + S V+VQ EDLF V TP Sbjct: 576 SGFRICKPQGTFLWPNKGIS--SPQVVVQFEDLFSVPTP 612