BLASTX nr result
ID: Angelica22_contig00041673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041673 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307605.1| sulfate/bicarbonate/oxalate exchanger and tr... 65 6e-09 emb|CBI26299.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002279213.1| PREDICTED: sulfate transporter 3.1 [Vitis vi... 64 1e-08 gb|ABK35750.1| sulfate transporter, partial [Populus tremula x P... 64 1e-08 ref|XP_002524733.1| sulfate transporter, putative [Ricinus commu... 64 2e-08 >ref|XP_002307605.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Populus trichocarpa] gi|222857054|gb|EEE94601.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Populus trichocarpa] Length = 655 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +3 Query: 3 LVNPGSEVMRKLGKSKLVERIGGECIYLTVGDAVNGISFMLHSHKSKSVESE 158 L NPG+EVM+KL KSKL+E+IG E +YLTVG+AV +FMLH+ K + E Sbjct: 597 LANPGAEVMKKLNKSKLIEKIGQEWMYLTVGEAVGACNFMLHTRKPDPLREE 648 >emb|CBI26299.3| unnamed protein product [Vitis vinifera] Length = 740 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +3 Query: 3 LVNPGSEVMRKLGKSKLVERIGGECIYLTVGDAVNGISFMLHSHKSKS 146 L NPGSEVM+KL KSK++E+IG E +YLTV +AV +FMLHS KS S Sbjct: 676 LANPGSEVMKKLDKSKMIEKIGEEWMYLTVAEAVGACNFMLHSCKSTS 723 >ref|XP_002279213.1| PREDICTED: sulfate transporter 3.1 [Vitis vinifera] Length = 654 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +3 Query: 3 LVNPGSEVMRKLGKSKLVERIGGECIYLTVGDAVNGISFMLHSHKSKS 146 L NPGSEVM+KL KSK++E+IG E +YLTV +AV +FMLHS KS S Sbjct: 590 LANPGSEVMKKLDKSKMIEKIGEEWMYLTVAEAVGACNFMLHSCKSTS 637 >gb|ABK35750.1| sulfate transporter, partial [Populus tremula x Populus alba] Length = 584 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +3 Query: 3 LVNPGSEVMRKLGKSKLVERIGGECIYLTVGDAVNGISFMLHSHKSKSVESE 158 L NPG+EV++KL KSKL+E+IG E +YLTVG+AV +FMLH+ K ++ E Sbjct: 526 LANPGAEVVKKLNKSKLIEKIGQEWMYLTVGEAVGACNFMLHTRKPDPLKEE 577 >ref|XP_002524733.1| sulfate transporter, putative [Ricinus communis] gi|223535917|gb|EEF37576.1| sulfate transporter, putative [Ricinus communis] Length = 550 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +3 Query: 3 LVNPGSEVMRKLGKSKLVERIGGECIYLTVGDAVNGISFMLHSHKSKSVESE 158 L NPGSEVM+KL K+K++E+IG E IYLTVG+AV ++MLH+ K ++ E Sbjct: 492 LANPGSEVMKKLNKAKVIEKIGQEWIYLTVGEAVGACNYMLHTCKPNPLKDE 543