BLASTX nr result
ID: Angelica22_contig00041621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041621 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530159.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_003519129.1| PREDICTED: uncharacterized protein LOC100818... 72 4e-11 ref|XP_003535805.1| PREDICTED: uncharacterized protein LOC100786... 72 5e-11 ref|XP_003520709.1| PREDICTED: uncharacterized protein LOC100804... 70 2e-10 ref|XP_003635863.1| hypothetical protein MTR_013s0006 [Medicago ... 69 5e-10 >ref|XP_002530159.1| conserved hypothetical protein [Ricinus communis] gi|223530320|gb|EEF32214.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +1 Query: 1 DLKELLNCFLQLNSPYHNGIIFRAFTEIWNGVYTGRAASSSNMHG 135 DLKELLNCFLQLNSPYH+GII RAFTEIWNGVY+ +++S + G Sbjct: 145 DLKELLNCFLQLNSPYHHGIIVRAFTEIWNGVYSVKSSSYNTATG 189 >ref|XP_003519129.1| PREDICTED: uncharacterized protein LOC100818531 [Glycine max] Length = 169 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +1 Query: 1 DLKELLNCFLQLNSPYHNGIIFRAFTEIWNGVYT-GRAASSSNMHGVHRSRDY 156 DL+ELLNCFLQLNSP H+G+I RAFTEIWNGV++ R+ SS+ H +SRD+ Sbjct: 117 DLRELLNCFLQLNSPDHHGVIVRAFTEIWNGVFSVRRSGSSTGFHLNRKSRDF 169 >ref|XP_003535805.1| PREDICTED: uncharacterized protein LOC100786450 [Glycine max] Length = 177 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/54 (62%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +1 Query: 1 DLKELLNCFLQLNSPYHNGIIFRAFTEIWNGVYT--GRAASSSNMHGVHRSRDY 156 DL+ELLNCFLQLNSP H+G+I RAFTEIWNGV++ R+ SS+ H +SRD+ Sbjct: 124 DLRELLNCFLQLNSPDHHGVIVRAFTEIWNGVFSVRRRSGSSTGFHLNRKSRDF 177 >ref|XP_003520709.1| PREDICTED: uncharacterized protein LOC100804319 [Glycine max] Length = 158 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +1 Query: 1 DLKELLNCFLQLNSPYHNGIIFRAFTEIWNGVYTGRAASSSNMH 132 DL+ELLNCFLQLNSP+H+G+I RAFTEIWNGV++ R SSS++H Sbjct: 111 DLRELLNCFLQLNSPHHHGVIVRAFTEIWNGVFSVR--SSSHIH 152 >ref|XP_003635863.1| hypothetical protein MTR_013s0006 [Medicago truncatula] gi|355501798|gb|AES83001.1| hypothetical protein MTR_013s0006 [Medicago truncatula] Length = 199 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 1 DLKELLNCFLQLNSPYHNGIIFRAFTEIWNGVYTGRAASSSNMHGVHRSRDY 156 DL+ELLNCFLQLN+PYH+G+I RAFTEIWNGV R +S S +H SR + Sbjct: 143 DLRELLNCFLQLNAPYHHGVIVRAFTEIWNGVSIMRPSSPS----LHTSRTH 190