BLASTX nr result
ID: Angelica22_contig00041614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041614 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK63415.1| CCCH type zinc finger protein [Brassica rapa] 44 2e-07 >gb|ADK63415.1| CCCH type zinc finger protein [Brassica rapa] Length = 556 Score = 43.9 bits (102), Expect(2) = 2e-07 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 211 PDENVQRSDPRKFHYGSVPLLDSHFGLAWRTDMLIYGHG 95 P EN +R DPRKFHY VP D G R DM + HG Sbjct: 123 PGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEFAHG 161 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 104 WSWQSQYGTQPCKDGISCKYRVCFF 30 W +QY T+ CKDG C RVCFF Sbjct: 166 WLHPAQYRTRLCKDGTGCARRVCFF 190