BLASTX nr result
ID: Angelica22_contig00041485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041485 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] 93 3e-17 ref|XP_002525819.1| 2-oxoglutarate/malate translocator, chloropl... 90 2e-16 ref|XP_002323748.1| 2-oxoglutarate/malate translocator [Populus ... 90 2e-16 ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata... 89 5e-16 ref|XP_002300194.1| 2-oxoglutarate/malate translocator [Populus ... 89 5e-16 >gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] Length = 583 Score = 92.8 bits (229), Expect = 3e-17 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 314 AVYFGAGYIDLPDIFKMGFLMALVNALIWGVVGTFWWKFLGLY 186 AVYFGAGY+DLPD+FKMGF+MALVNA IWGVVGTFWWKFLGLY Sbjct: 541 AVYFGAGYVDLPDVFKMGFIMALVNATIWGVVGTFWWKFLGLY 583 >ref|XP_002525819.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative [Ricinus communis] gi|223534824|gb|EEF36513.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative [Ricinus communis] Length = 337 Score = 90.1 bits (222), Expect = 2e-16 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -3 Query: 314 AVYFGAGYIDLPDIFKMGFLMALVNALIWGVVGTFWWKFLGLY 186 AVY+GAGY+DLPD+FKMGF++AL+NA+IWGVVGTFWWKFLGLY Sbjct: 295 AVYYGAGYVDLPDVFKMGFVIALINAVIWGVVGTFWWKFLGLY 337 >ref|XP_002323748.1| 2-oxoglutarate/malate translocator [Populus trichocarpa] gi|222866750|gb|EEF03881.1| 2-oxoglutarate/malate translocator [Populus trichocarpa] Length = 569 Score = 89.7 bits (221), Expect = 2e-16 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 314 AVYFGAGYIDLPDIFKMGFLMALVNALIWGVVGTFWWKFLGLY 186 AVY+GAGY+DLPD+FKMGF MAL+NA+IWGV GTFWWKFLGLY Sbjct: 527 AVYYGAGYVDLPDVFKMGFTMALINAIIWGVTGTFWWKFLGLY 569 >ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] gi|297312442|gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 88.6 bits (218), Expect = 5e-16 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -3 Query: 314 AVYFGAGYIDLPDIFKMGFLMALVNALIWGVVGTFWWKFLGLY 186 AVY+GAGY+DLPD+FK+GF+MA +NA+IWGVVGTFWWKFLGLY Sbjct: 519 AVYYGAGYVDLPDVFKIGFVMATINAIIWGVVGTFWWKFLGLY 561 >ref|XP_002300194.1| 2-oxoglutarate/malate translocator [Populus trichocarpa] gi|222847452|gb|EEE84999.1| 2-oxoglutarate/malate translocator [Populus trichocarpa] Length = 573 Score = 88.6 bits (218), Expect = 5e-16 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -3 Query: 314 AVYFGAGYIDLPDIFKMGFLMALVNALIWGVVGTFWWKFLGLY 186 AVY+GAGY+DLPD+FK+GF+MAL+NA+IWGV GTFWWKFLGLY Sbjct: 531 AVYYGAGYMDLPDVFKLGFVMALINAIIWGVTGTFWWKFLGLY 573