BLASTX nr result
ID: Angelica22_contig00041129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00041129 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521903.1| serine/threonine-protein kinase bri1, putati... 60 2e-07 gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glyc... 56 3e-06 ref|NP_001237994.1| ATP binding/protein serine/threonine kinase ... 56 3e-06 ref|XP_002312487.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003532682.1| PREDICTED: serine/threonine-protein kinase B... 55 5e-06 >ref|XP_002521903.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223538941|gb|EEF40539.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 1140 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 353 YLQITLQCVDDFPSKRPNMLQIVAMLRQLL 264 YL+ITLQCVDDFPSKRPNMLQ+VAMLR+L+ Sbjct: 1100 YLEITLQCVDDFPSKRPNMLQVVAMLRELM 1129 >gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glycine max] Length = 1086 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 353 YLQITLQCVDDFPSKRPNMLQIVAMLRQLL 264 YL+ITLQCVDD PS+RPNMLQ+VAMLR+L+ Sbjct: 1046 YLEITLQCVDDLPSRRPNMLQVVAMLRELM 1075 >ref|NP_001237994.1| ATP binding/protein serine/threonine kinase [Glycine max] gi|212717135|gb|ACJ37409.1| ATP binding/protein serine/threonine kinase [Glycine max] Length = 1173 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 353 YLQITLQCVDDFPSKRPNMLQIVAMLRQLL 264 YL+ITLQCVDD PS+RPNMLQ+VAMLR+L+ Sbjct: 1133 YLEITLQCVDDLPSRRPNMLQVVAMLRELM 1162 >ref|XP_002312487.1| predicted protein [Populus trichocarpa] gi|222852307|gb|EEE89854.1| predicted protein [Populus trichocarpa] Length = 1134 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 353 YLQITLQCVDDFPSKRPNMLQIVAMLRQLL 264 YL+I+LQCVDDFPSKRP+MLQ+VAMLR+L+ Sbjct: 1094 YLEISLQCVDDFPSKRPSMLQVVAMLRELM 1123 >ref|XP_003532682.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Glycine max] Length = 1196 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 353 YLQITLQCVDDFPSKRPNMLQIVAMLRQLL 264 YL+IT+QCVDD PS+RPNMLQ+VAMLR+L+ Sbjct: 1156 YLEITMQCVDDLPSRRPNMLQVVAMLRELM 1185