BLASTX nr result
ID: Angelica22_contig00040953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00040953 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529492.1| hypothetical protein RCOM_0455440 [Ricinus c... 57 2e-06 emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] 55 8e-06 >ref|XP_002529492.1| hypothetical protein RCOM_0455440 [Ricinus communis] gi|223531050|gb|EEF32902.1| hypothetical protein RCOM_0455440 [Ricinus communis] Length = 129 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = -3 Query: 268 FPSL*ILRLRYLPNLEEWHVKDGALPSLKGFQIDHCEKLNMIPEQVRCV 122 FP L +L+L+ L LEEW+V++GALPSLK +I+ C L +IP+ +R V Sbjct: 42 FPKLEVLKLKKLMELEEWNVEEGALPSLKDLEIESCSNLKIIPDGLRLV 90 >emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Length = 902 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -3 Query: 268 FPSL*ILRLRYLPNLEEWHVKDGALPSLKGFQIDHCEKLNMIPE 137 FP L L L L NLEEW V DGA+PSL+ IDHC++L IPE Sbjct: 818 FPKLHGLELSELVNLEEWRVDDGAMPSLRHLVIDHCDQLKKIPE 861