BLASTX nr result
ID: Angelica22_contig00040882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00040882 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521923.1| PREDICTED: U-box domain-containing protein 1... 58 7e-07 ref|XP_002511794.1| ubiquitin-protein ligase, putative [Ricinus ... 58 7e-07 emb|CAA06793.1| hypothetical protein [Cicer arietinum] 57 2e-06 gb|AER13165.1| armadillo [Phaseolus vulgaris] 57 2e-06 ref|XP_003534592.1| PREDICTED: vacuolar protein 8-like [Glycine ... 57 2e-06 >ref|XP_003521923.1| PREDICTED: U-box domain-containing protein 12-like [Glycine max] Length = 565 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 3 KKCKKLMISYGAIGYLKKLTEMDIPSAXXXXXXXXXXXXXXXFSRK 140 KKCKKLMISYGAIGYLKKLTEMDIP A FSRK Sbjct: 520 KKCKKLMISYGAIGYLKKLTEMDIPGAKKLLERLERGKLRSLFSRK 565 >ref|XP_002511794.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223548974|gb|EEF50463.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 561 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 3 KKCKKLMISYGAIGYLKKLTEMDIPSAXXXXXXXXXXXXXXXFSRK 140 KKCKKLMISYGAIGYLKKLTEMDIP A FSRK Sbjct: 516 KKCKKLMISYGAIGYLKKLTEMDIPGAKKLLERLERGKLRSLFSRK 561 >emb|CAA06793.1| hypothetical protein [Cicer arietinum] Length = 106 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 106 SNRSSSFFALGMSISVSFLRYPMAPYEIISFLHFL 2 SN S SF A +SISVSFLRYP+APYEIISFLHFL Sbjct: 55 SNLSCSFLAPAISISVSFLRYPIAPYEIISFLHFL 89 >gb|AER13165.1| armadillo [Phaseolus vulgaris] Length = 556 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = +3 Query: 3 KKCKKLMISYGAIGYLKKLTEMDIPSAXXXXXXXXXXXXXXXFSRK 140 KKCKKLMISYGAIGYLKKLTEMDIP A FS+K Sbjct: 511 KKCKKLMISYGAIGYLKKLTEMDIPGAKKLHERLERGKLRSLFSKK 556 >ref|XP_003534592.1| PREDICTED: vacuolar protein 8-like [Glycine max] Length = 559 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = +3 Query: 3 KKCKKLMISYGAIGYLKKLTEMDIPSAXXXXXXXXXXXXXXXFSRK 140 KKCKKLMISYGAIGYLKKLTEMDIP A FS+K Sbjct: 514 KKCKKLMISYGAIGYLKKLTEMDIPGAKKLHERLERGKFRSLFSKK 559