BLASTX nr result
ID: Angelica22_contig00040593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00040593 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] 62 5e-08 gb|AFK46483.1| unknown [Medicago truncatula] 60 1e-07 ref|XP_003607047.1| GATA transcription factor [Medicago truncatu... 60 1e-07 ref|XP_002521500.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003540668.1| PREDICTED: GATA transcription factor 7-like ... 59 4e-07 >dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] Length = 326 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 253 RPACSPTFAGHIHSNSHRKVLEMRRKKEAVEYVMSGL 143 RPACSPTF+ +HSNSHRKVLEMRRKKE+ E V SGL Sbjct: 283 RPACSPTFSQEVHSNSHRKVLEMRRKKESGEVVDSGL 319 >gb|AFK46483.1| unknown [Medicago truncatula] Length = 296 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 253 RPACSPTFAGHIHSNSHRKVLEMRRKKEAVEYVMSGLTPI 134 RPACSPTF+G IHSNSHRKVLEMRR+KE V+ +SGL I Sbjct: 252 RPACSPTFSGEIHSNSHRKVLEMRRRKE-VDEPVSGLNRI 290 >ref|XP_003607047.1| GATA transcription factor [Medicago truncatula] gi|355508102|gb|AES89244.1| GATA transcription factor [Medicago truncatula] Length = 296 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 253 RPACSPTFAGHIHSNSHRKVLEMRRKKEAVEYVMSGLTPI 134 RPACSPTF+G IHSNSHRKVLEMRR+KE V+ +SGL I Sbjct: 252 RPACSPTFSGEIHSNSHRKVLEMRRRKE-VDEPVSGLNRI 290 >ref|XP_002521500.1| conserved hypothetical protein [Ricinus communis] gi|223539178|gb|EEF40771.1| conserved hypothetical protein [Ricinus communis] Length = 398 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -3 Query: 253 RPACSPTFAGHIHSNSHRKVLEMRRKKEAVEYVMSGLTP 137 RPACSPTF +HSN HRKVLEMR+KKE V V GL P Sbjct: 354 RPACSPTFCSELHSNHHRKVLEMRKKKEVVVQVEPGLVP 392 >ref|XP_003540668.1| PREDICTED: GATA transcription factor 7-like [Glycine max] Length = 289 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 253 RPACSPTFAGHIHSNSHRKVLEMRRKKEAVE 161 RPACSPTF+ IHSNSHRKVLEMRRKKE VE Sbjct: 249 RPACSPTFSDDIHSNSHRKVLEMRRKKEIVE 279