BLASTX nr result
ID: Angelica22_contig00040381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00040381 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28596.3| unnamed protein product [Vitis vinifera] 55 3e-12 ref|XP_002271319.1| PREDICTED: uncharacterized protein LOC100244... 54 5e-12 ref|XP_002527954.1| lactoylglutathione lyase, putative [Ricinus ... 56 1e-11 gb|AAK97724.1| At2g28420/T1B3.6 [Arabidopsis thaliana] gi|169744... 51 1e-11 ref|NP_029429.1| lactoylglutathione lyase / glyoxalase I-like pr... 51 1e-11 >emb|CBI28596.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 55.1 bits (131), Expect(2) = 3e-12 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 357 CNCENLKLVPAESFRRIKLPIDRHVPPVDMPNTENSDA 244 CNCENLKLVPA S +IKLP+DRH PPV++ N + ++ Sbjct: 182 CNCENLKLVPAGSLGQIKLPLDRHNPPVELANGNHGES 219 Score = 41.2 bits (95), Expect(2) = 3e-12 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -3 Query: 431 SVGDGVGAAIDQLFFKDPDGFMIEIAIARILSL 333 ++ D G AIDQLFF DPDGFMIEI L L Sbjct: 157 TIKDEHGTAIDQLFFNDPDGFMIEICNCENLKL 189 >ref|XP_002271319.1| PREDICTED: uncharacterized protein LOC100244855 [Vitis vinifera] Length = 188 Score = 54.3 bits (129), Expect(2) = 5e-12 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 357 CNCENLKLVPAESFRRIKLPIDRHVPPVDMPN 262 CNCENLKLVPA S +IKLP+DRH PPV++ N Sbjct: 145 CNCENLKLVPAGSLGQIKLPLDRHNPPVELAN 176 Score = 41.2 bits (95), Expect(2) = 5e-12 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -3 Query: 431 SVGDGVGAAIDQLFFKDPDGFMIEIAIARILSL 333 ++ D G AIDQLFF DPDGFMIEI L L Sbjct: 120 TIKDEHGTAIDQLFFNDPDGFMIEICNCENLKL 152 >ref|XP_002527954.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223532658|gb|EEF34443.1| lactoylglutathione lyase, putative [Ricinus communis] Length = 201 Score = 56.2 bits (134), Expect(2) = 1e-11 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 357 CNCENLKLVPAESFRRIKLPIDRHVPPVDMPNTEN 253 CNCENLKL PA S +IKLP DRH+PPVD+ N N Sbjct: 159 CNCENLKLAPAGSIGKIKLPKDRHIPPVDVENGRN 193 Score = 38.1 bits (87), Expect(2) = 1e-11 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 422 DGVGAAIDQLFFKDPDGFMIEIAIARILSL 333 D G IDQLFF DPDGFMIEI L L Sbjct: 137 DENGTKIDQLFFDDPDGFMIEICNCENLKL 166 >gb|AAK97724.1| At2g28420/T1B3.6 [Arabidopsis thaliana] gi|16974407|gb|AAL31129.1| At2g28420/T1B3.6 [Arabidopsis thaliana] Length = 184 Score = 50.8 bits (120), Expect(2) = 1e-11 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -2 Query: 357 CNCENLKLVPAESFRRIKLPIDRHVPPVDMPNTEN 253 CNCENL+LVP S I+LP DRH PPV +P++ N Sbjct: 142 CNCENLELVPCHSADAIRLPEDRHAPPVALPDSSN 176 Score = 43.5 bits (101), Expect(2) = 1e-11 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -3 Query: 431 SVGDGVGAAIDQLFFKDPDGFMIEIAIARILSL 333 +VGD AAIDQLFF DPDGFM+EI L L Sbjct: 117 TVGDEKDAAIDQLFFNDPDGFMVEICNCENLEL 149 >ref|NP_029429.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis thaliana] gi|4432835|gb|AAD20684.1| expressed protein [Arabidopsis thaliana] gi|330253026|gb|AEC08120.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis thaliana] Length = 184 Score = 50.8 bits (120), Expect(2) = 1e-11 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -2 Query: 357 CNCENLKLVPAESFRRIKLPIDRHVPPVDMPNTEN 253 CNCENL+LVP S I+LP DRH PPV +P++ N Sbjct: 142 CNCENLELVPCHSADAIRLPEDRHAPPVALPDSSN 176 Score = 43.5 bits (101), Expect(2) = 1e-11 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -3 Query: 431 SVGDGVGAAIDQLFFKDPDGFMIEIAIARILSL 333 +VGD AAIDQLFF DPDGFM+EI L L Sbjct: 117 TVGDEKDAAIDQLFFNDPDGFMVEICNCENLEL 149