BLASTX nr result
ID: Angelica22_contig00039912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039912 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320852.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_004139659.1| PREDICTED: probable WRKY transcription facto... 73 2e-11 ref|XP_004164459.1| PREDICTED: probable WRKY transcription facto... 73 2e-11 gb|ACV92008.1| WRKY transcription factor 6 [(Populus tomentosa x... 73 2e-11 gb|AEQ29019.1| WRKY6 [Panax quinquefolius] 70 1e-10 >ref|XP_002320852.1| predicted protein [Populus trichocarpa] gi|222861625|gb|EEE99167.1| predicted protein [Populus trichocarpa] Length = 365 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 3/57 (5%) Frame = -1 Query: 361 YRCTHRLTQGCLATKQVQQSDEDQNIFHITCKGRHTCNQTTQS---SNMPGKELTRQ 200 YRCTHR +QGCLATKQVQ+SDED +IF +T +GRHTCNQ + S S P + ++Q Sbjct: 152 YRCTHRHSQGCLATKQVQRSDEDHSIFEVTYRGRHTCNQASPSPVASPSPKNDCSKQ 208 >ref|XP_004139659.1| PREDICTED: probable WRKY transcription factor 46-like [Cucumis sativus] Length = 296 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 361 YRCTHRLTQGCLATKQVQQSDEDQNIFHITCKGRHTCNQTTQSSNMP 221 +RC+HR TQGCLATKQVQ+SD D I+ +T KGRHTCN+ S+N P Sbjct: 124 FRCSHRFTQGCLATKQVQKSDNDPTIYEVTYKGRHTCNKALHSTNTP 170 >ref|XP_004164459.1| PREDICTED: probable WRKY transcription factor 53-like [Cucumis sativus] gi|315613844|gb|ADU52527.1| WRKY protein [Cucumis sativus] Length = 296 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 361 YRCTHRLTQGCLATKQVQQSDEDQNIFHITCKGRHTCNQTTQSSNMP 221 +RC+HR TQGCLATKQVQ+SD D I+ +T KGRHTCN+ S+N P Sbjct: 124 FRCSHRFTQGCLATKQVQKSDNDPTIYEVTYKGRHTCNKALHSTNTP 170 >gb|ACV92008.1| WRKY transcription factor 6 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 369 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 3/57 (5%) Frame = -1 Query: 361 YRCTHRLTQGCLATKQVQQSDEDQNIFHITCKGRHTCNQTTQS---SNMPGKELTRQ 200 YRCTHR +QGCLATKQVQ+SDED +IF +T +GRHTCNQ + S S P + ++Q Sbjct: 152 YRCTHRHSQGCLATKQVQRSDEDHSIFEVTYQGRHTCNQASPSPLASPSPKNDCSKQ 208 >gb|AEQ29019.1| WRKY6 [Panax quinquefolius] Length = 346 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 361 YRCTHRLTQGCLATKQVQQSDEDQNIFHITCKGRHTCNQTT 239 YRCTHR QGCLATKQVQ+SDED +I IT +GRHTCNQT+ Sbjct: 146 YRCTHRHAQGCLATKQVQKSDEDPSILGITYRGRHTCNQTS 186