BLASTX nr result
ID: Angelica22_contig00039834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039834 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp.... 63 3e-08 gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] 57 1e-06 >ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -2 Query: 173 PNPFIRRAVYCK*SEPAWSEPPIEASEVGEPYDGQLSPAVRRGLSC 36 PNPF+ + + P S PP+EASEVGEPYDGQLSPAVRRGLSC Sbjct: 55 PNPFVGPCIVSDPNLPGAS-PPLEASEVGEPYDGQLSPAVRRGLSC 99 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 205 QEKNHIENAPNPTPLFVEPCIVSDPNLPGASPP 107 Q KNH+ENAPNP FV PCIVSDPNLPGASPP Sbjct: 46 QRKNHLENAPNP---FVGPCIVSDPNLPGASPP 75 >gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] Length = 77 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 170 NPFIRRAVYCK*SEPAWSEPPIEASEVGEPYDGQLSPAVRRGLS 39 NPF+ + + P S PP+EASEVGEPYDGQLSPAVRRGLS Sbjct: 34 NPFVGPCIVSDPNLPGAS-PPLEASEVGEPYDGQLSPAVRRGLS 76 Score = 20.8 bits (42), Expect(2) = 1e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -1 Query: 204 RKRIILKTLL 175 +KRIILKTLL Sbjct: 24 KKRIILKTLL 33