BLASTX nr result
ID: Angelica22_contig00039785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039785 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV60642.1| Hsp70-interacting protein 1 [Daucus carota] 87 2e-15 gb|ABY87519.1| Hsp70-interacting protein 1 [Vitis labrusca] 74 9e-12 emb|CAN68309.1| hypothetical protein VITISV_043507 [Vitis vinifera] 74 9e-12 ref|XP_002264256.2| PREDICTED: FAM10 family protein At4g22670-li... 71 8e-11 emb|CBI28504.3| unnamed protein product [Vitis vinifera] 71 8e-11 >gb|ACV60642.1| Hsp70-interacting protein 1 [Daucus carota] Length = 69 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = +3 Query: 69 MEAKMLSDLKDFIQQCKADPSILTHPSLSFFTDYLRSVGGELPQAAYKSGGHKSAY 236 M+AK LS+LK FI+QCKA+PSIL+ PSLSFF DYL SVG +LPQ+AYKSG HK AY Sbjct: 1 MDAKKLSELKQFIEQCKANPSILSDPSLSFFRDYLESVGCKLPQSAYKSGDHKPAY 56 >gb|ABY87519.1| Hsp70-interacting protein 1 [Vitis labrusca] Length = 417 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +3 Query: 69 MEAKMLSDLKDFIQQCKADPSILTHPSLSFFTDYLRSVGGELPQAAYKSGGHKS 230 M+ L LK FI+QCKADPSIL++P+LSFF DYL S+G +LP +AYKSG KS Sbjct: 1 MDGDKLDQLKQFIEQCKADPSILSNPTLSFFRDYLESLGADLPPSAYKSGDSKS 54 >emb|CAN68309.1| hypothetical protein VITISV_043507 [Vitis vinifera] Length = 374 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +3 Query: 69 MEAKMLSDLKDFIQQCKADPSILTHPSLSFFTDYLRSVGGELPQAAYKSGGHKS 230 M+ L LK FI+QCKADPSIL++P+LSFF DYL S+G +LP +AYKSG KS Sbjct: 1 MDGDKLDQLKQFIEQCKADPSILSNPTLSFFRDYLESLGADLPPSAYKSGDSKS 54 >ref|XP_002264256.2| PREDICTED: FAM10 family protein At4g22670-like [Vitis vinifera] Length = 409 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = +3 Query: 69 MEAKMLSDLKDFIQQCKADPSILTHPSLSFFTDYLRSVGGELPQAAYKSGGHKS 230 M+ L LK FI+QCKADPSIL++P+LSFF DYL S+G +LP +AYKS KS Sbjct: 1 MDGDKLDQLKQFIEQCKADPSILSNPTLSFFRDYLESLGADLPPSAYKSEDSKS 54 >emb|CBI28504.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = +3 Query: 69 MEAKMLSDLKDFIQQCKADPSILTHPSLSFFTDYLRSVGGELPQAAYKSGGHKS 230 M+ L LK FI+QCKADPSIL++P+LSFF DYL S+G +LP +AYKS KS Sbjct: 1 MDGDKLDQLKQFIEQCKADPSILSNPTLSFFRDYLESLGADLPPSAYKSEDSKS 54