BLASTX nr result
ID: Angelica22_contig00039747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039747 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515700.1| huntingtin interacting protein, putative [Ri... 57 2e-06 ref|XP_002327831.1| SET domain protein [Populus trichocarpa] gi|... 55 6e-06 >ref|XP_002515700.1| huntingtin interacting protein, putative [Ricinus communis] gi|223545137|gb|EEF46647.1| huntingtin interacting protein, putative [Ricinus communis] Length = 2430 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -3 Query: 224 TVENAVSPLVTSNFPSNSSDTVNQSVTLSEPPDNELDDEGDVMQFGCQIGDE 69 T+ENAVSPLV SNFPS SDTV + V+ E P N L D GD+ Q G + G+E Sbjct: 724 TIENAVSPLVASNFPSIVSDTVTRLVSPPEAPGNLLADTGDMGQSGYKNGEE 775 >ref|XP_002327831.1| SET domain protein [Populus trichocarpa] gi|222837240|gb|EEE75619.1| SET domain protein [Populus trichocarpa] Length = 2476 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -3 Query: 224 TVENAVSPLVTSNFPSNSSDTVNQSVTLSEPPDNELDDEGDVMQFGCQIGD 72 T+ENAVSPLVT NFPS D + Q V+ E P N L D GD++Q QIG+ Sbjct: 760 TIENAVSPLVTVNFPSVVPDVITQLVSPPEAPGNLLADTGDIVQSCSQIGE 810