BLASTX nr result
ID: Angelica22_contig00039690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039690 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528824.1| conserved hypothetical protein [Ricinus comm... 81 8e-14 emb|CAN71290.1| hypothetical protein VITISV_019350 [Vitis vinifera] 80 2e-13 emb|CBI23675.3| unnamed protein product [Vitis vinifera] 79 3e-13 ref|XP_002281751.1| PREDICTED: uncharacterized protein LOC100258... 79 3e-13 ref|XP_004134406.1| PREDICTED: uncharacterized protein LOC101211... 67 2e-09 >ref|XP_002528824.1| conserved hypothetical protein [Ricinus communis] gi|223531736|gb|EEF33558.1| conserved hypothetical protein [Ricinus communis] Length = 919 Score = 81.3 bits (199), Expect = 8e-14 Identities = 63/140 (45%), Positives = 76/140 (54%), Gaps = 19/140 (13%) Frame = -2 Query: 412 MSALSLRRSKDP--TSGTKLTAIKPTITSKPIKSTTPVSKSLMGSTGKDSI--KRSSGKE 245 MSA S RR KD T+G K++A++ KP KS TP+S S S DS K +S KE Sbjct: 1 MSAPSTRRLKDRNGTTGAKISAVQ-----KPAKSLTPISNS---SPNPDSALKKSASAKE 52 Query: 244 NPRPISRIGGFEGSVKAVFRNVPRIEK--------GSGGFDNRLRWSTSSVPRGRSESPC 89 NPR SRI K + VPR++K GS G + R+RWSTSSVPRGRS SP Sbjct: 53 NPRLNSRIQ------KPTIKPVPRVDKAAAAAVVPGSDGGEGRMRWSTSSVPRGRSSSPS 106 Query: 88 EISRGF-------GGFDNRL 50 E R F G DNR+ Sbjct: 107 EFIRVFRDSRVSKGESDNRV 126 >emb|CAN71290.1| hypothetical protein VITISV_019350 [Vitis vinifera] Length = 937 Score = 80.1 bits (196), Expect = 2e-13 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 5/117 (4%) Frame = -2 Query: 412 MSALSLRRSKDPT-SGTKLTAIKPTITSKPIKSTTPVSKSLMGSTGKDSIKRSSGKENPR 236 MSA S+RR KD +G K+TA++P+ T P+ P+ K S+GKENPR Sbjct: 1 MSASSVRRIKDRGGAGGKVTAMRPSKTLTPVSDKAPIETFR---------KSSAGKENPR 51 Query: 235 PISRIGGFEGSVKAVFRNVPRIEKGSGGF----DNRLRWSTSSVPRGRSESPCEISR 77 P SR+ + K R +PRI+K S G ++R+RWSTSSVPRGRS SP + +R Sbjct: 52 PTSRLPAV--TQKPAIRAMPRIDKLSAGNGSDGESRVRWSTSSVPRGRSSSPSDFTR 106 >emb|CBI23675.3| unnamed protein product [Vitis vinifera] Length = 910 Score = 79.3 bits (194), Expect = 3e-13 Identities = 51/117 (43%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Frame = -2 Query: 412 MSALSLRRSKDPT-SGTKLTAIKPTITSKPIKSTTPVSKSLMGSTGKDSIKRSSGKENPR 236 MSA S+RR KD +G K+TA++P+ T P+ P+ K S+GKENPR Sbjct: 1 MSASSVRRIKDRGGAGGKVTAMRPSKTLTPVSDKAPIETFR---------KSSAGKENPR 51 Query: 235 PISRIGGFEGSVKAVFRNVPRIEKGSGGF----DNRLRWSTSSVPRGRSESPCEISR 77 P SR+ K R +PRI+K S G ++R+RWSTSSVPRGRS SP + +R Sbjct: 52 PTSRLPAV--MQKPAIRAMPRIDKLSAGNGSDGESRVRWSTSSVPRGRSSSPSDFTR 106 >ref|XP_002281751.1| PREDICTED: uncharacterized protein LOC100258054 [Vitis vinifera] Length = 986 Score = 79.3 bits (194), Expect = 3e-13 Identities = 51/117 (43%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Frame = -2 Query: 412 MSALSLRRSKDPT-SGTKLTAIKPTITSKPIKSTTPVSKSLMGSTGKDSIKRSSGKENPR 236 MSA S+RR KD +G K+TA++P+ T P+ P+ K S+GKENPR Sbjct: 1 MSASSVRRIKDRGGAGGKVTAMRPSKTLTPVSDKAPIETFR---------KSSAGKENPR 51 Query: 235 PISRIGGFEGSVKAVFRNVPRIEKGSGGF----DNRLRWSTSSVPRGRSESPCEISR 77 P SR+ K R +PRI+K S G ++R+RWSTSSVPRGRS SP + +R Sbjct: 52 PTSRLPAV--MQKPAIRAMPRIDKLSAGNGSDGESRVRWSTSSVPRGRSSSPSDFTR 106 >ref|XP_004134406.1| PREDICTED: uncharacterized protein LOC101211564 [Cucumis sativus] gi|449486780|ref|XP_004157400.1| PREDICTED: uncharacterized LOC101211564 [Cucumis sativus] Length = 949 Score = 66.6 bits (161), Expect = 2e-09 Identities = 56/137 (40%), Positives = 71/137 (51%), Gaps = 5/137 (3%) Frame = -2 Query: 412 MSALSLRRSKDPTSGTKLTAIKPTITSKPIKSTTPVSKSLMGSTGKDSIK-RSSGKENPR 236 MSA S RR +D + G+ PTI P K TPVS S + S + S+GKENP+ Sbjct: 1 MSAPSTRRLRDRSGGSA-----PTIN--PSKPLTPVSTSNRKNNSDSSSRFASAGKENPK 53 Query: 235 PISRIGGFEGSVKAVFRNVPRIEKGSG----GFDNRLRWSTSSVPRGRSESPCEISRGFG 68 S++ + K R VPR+ K + + R RWS+SSVPRGRS SP E R Sbjct: 54 STSKLPIM--TQKPSIRAVPRVNKAAAIAVSDSETRSRWSSSSVPRGRSSSPSEFIR--S 109 Query: 67 GFDNRLRWSTSSVPRGR 17 D+R R SV RGR Sbjct: 110 SVDSR-RERRVSVDRGR 125