BLASTX nr result
ID: Angelica22_contig00039644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039644 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69956.1| hypothetical protein VITISV_032883 [Vitis vinifera] 71 2e-25 emb|CAN65377.1| hypothetical protein VITISV_014188 [Vitis vinifera] 75 2e-24 emb|CAN67027.1| hypothetical protein VITISV_036244 [Vitis vinifera] 74 7e-24 emb|CAN64779.1| hypothetical protein VITISV_043230 [Vitis vinifera] 71 2e-22 emb|CAN67797.1| hypothetical protein VITISV_038915 [Vitis vinifera] 71 2e-22 >emb|CAN69956.1| hypothetical protein VITISV_032883 [Vitis vinifera] Length = 811 Score = 71.2 bits (173), Expect(2) = 2e-25 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = -1 Query: 295 LHEKNLPKKFWAEATNTAVFLQNRLPTRVL*DKTPYEIWYEDKPSLNFLK 146 LHEK LPKK WAE NT VFL NRLPTRVL KTP+E W+ KP L L+ Sbjct: 298 LHEKELPKKLWAETANTVVFLLNRLPTRVLQKKTPFEAWFGYKPDLQNLR 347 Score = 69.3 bits (168), Expect(2) = 2e-25 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -3 Query: 146 SIGCLCFTHAPHVKRDKLDKRALPGIFIGYSLATKTNYRVFQPQTGNI 3 + GCLCF++ P VKRDKLDK+A PG+FIGYS +++ YR+FQPQ G I Sbjct: 348 TFGCLCFSYVPQVKRDKLDKKAKPGVFIGYSNSSEA-YRIFQPQNGKI 394 >emb|CAN65377.1| hypothetical protein VITISV_014188 [Vitis vinifera] Length = 738 Score = 75.1 bits (183), Expect(2) = 2e-24 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = -1 Query: 295 LHEKNLPKKFWAEATNTAVFLQNRLPTRVL*DKTPYEIWYEDKPSLNFLK 146 LHEK LPKKFWAEA +T+VFL NRLPT+ L KTP+E WY+ KP L LK Sbjct: 88 LHEKGLPKKFWAEAAHTSVFLLNRLPTKALQQKTPFEAWYDYKPRLQNLK 137 Score = 62.4 bits (150), Expect(2) = 2e-24 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -3 Query: 146 SIGCLCFTHAPHVKRDKLDKRALPGIFIGYSLATKTNYRVFQPQTGNI 3 + GCLCF++ PHVKRDKLDK+A GIFIGYS +K YR++ P+ + Sbjct: 138 TFGCLCFSYIPHVKRDKLDKKAEAGIFIGYSSISKA-YRIYLPENNKV 184 >emb|CAN67027.1| hypothetical protein VITISV_036244 [Vitis vinifera] Length = 261 Score = 73.9 bits (180), Expect(2) = 7e-24 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = -1 Query: 286 KNLPKKFWAEATNTAVFLQNRLPTRVL*DKTPYEIWYEDKPSLNFLKVLD 137 K L KKFWA+ATNT VFL NRLPT+ L DKT +E WY KPSL+FL+V D Sbjct: 149 KELSKKFWAKATNTTVFLYNRLPTKALNDKTSFEAWYGYKPSLDFLRVFD 198 Score = 61.6 bits (148), Expect(2) = 7e-24 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 137 CLCFTHAPHVKRDKLDKRALPGIFIGYSLATKTNYRVFQPQTGNI 3 C+CF+H VKRDKLDK+ PGIFIGY+ + K Y+V+QPQTG + Sbjct: 199 CVCFSHVSQVKRDKLDKKLEPGIFIGYNSSFKA-YKVYQPQTGKL 242 >emb|CAN64779.1| hypothetical protein VITISV_043230 [Vitis vinifera] Length = 1102 Score = 71.2 bits (173), Expect(2) = 2e-22 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = -1 Query: 295 LHEKNLPKKFWAEATNTAVFLQNRLPTRVL*DKTPYEIWYEDKPSLNFLK 146 LHEK LPKKFWAEA +T+VFL NRLPT+ L TP+E WY KP L LK Sbjct: 452 LHEKGLPKKFWAEAAHTSVFLLNRLPTKALQQXTPFEAWYGYKPRLQNLK 501 Score = 59.7 bits (143), Expect(2) = 2e-22 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 146 SIGCLCFTHAPHVKRDKLDKRALPGIFIGYSLATKTNYRVFQPQTGNI 3 + GCLCF++ PHVKRDKLDK+A IFIGYS +K YR++ P+ + Sbjct: 502 TFGCLCFSYIPHVKRDKLDKKAEAXIFIGYSSISKA-YRIYLPENNKV 548 >emb|CAN67797.1| hypothetical protein VITISV_038915 [Vitis vinifera] Length = 518 Score = 71.2 bits (173), Expect(2) = 2e-22 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -1 Query: 295 LHEKNLPKKFWAEATNTAVFLQNRLPTRVL*DKTPYEIWYEDKPSLNFLKVL 140 LH+K LPKKFW EA +T+VFL NRLPT+ L KTP+E WY KP L LK + Sbjct: 413 LHDKGLPKKFWTEAAHTSVFLLNRLPTKALQQKTPFEAWYGYKPRLQNLKTV 464 Score = 59.3 bits (142), Expect(2) = 2e-22 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 146 SIGCLCFTHAPHVKRDKLDKRALPGIFIGYSLATKTNYRVF 24 ++GCLCF++ PHVKRDKLDK+A GIFIGYS +K YR++ Sbjct: 463 TVGCLCFSYIPHVKRDKLDKKAEVGIFIGYSSISKA-YRIY 502