BLASTX nr result
ID: Angelica22_contig00039608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039608 (728 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516822.1| conserved hypothetical protein [Ricinus comm... 56 9e-06 >ref|XP_002516822.1| conserved hypothetical protein [Ricinus communis] gi|223543910|gb|EEF45436.1| conserved hypothetical protein [Ricinus communis] Length = 361 Score = 55.8 bits (133), Expect = 9e-06 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 9/122 (7%) Frame = -2 Query: 727 NAEEEVFEQIQTPSSI------KSFLSSNLGLLDGCLCICMKYINYIG-LWVMSGDGDEN 569 N E F +I +PS + KS +G+L GCLC+ + I +W+M G++ Sbjct: 186 NFGNEQFGEIPSPSVLVSKGKKKSMGLMKVGVLRGCLCMSLSSAQKISEIWIMKEYGNKE 245 Query: 568 SWTKKVVLRNLGIGPNR--TVEPLKCLENGDIVILCYPLYAICYNPTTRSRKYIRFDDHK 395 SWTK +V+ + + R + EP+ ++ +I++LC CYN T+ RF D K Sbjct: 246 SWTKLLVIGTICLSKIRYNSCEPIFAFDSDNILMLCDNSVLACYNVKTK-----RFRDAK 300 Query: 394 AS 389 S Sbjct: 301 IS 302