BLASTX nr result
ID: Angelica22_contig00039488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039488 (571 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528752.1| pentatricopeptide repeat-containing protein,... 97 2e-18 ref|XP_002308078.1| predicted protein [Populus trichocarpa] gi|2... 96 3e-18 dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis tha... 95 7e-18 gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|A... 95 7e-18 ref|NP_181166.3| pentatricopeptide repeat-containing protein [Ar... 95 7e-18 >ref|XP_002528752.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531846|gb|EEF33664.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 371 Score = 96.7 bits (239), Expect = 2e-18 Identities = 48/80 (60%), Positives = 59/80 (73%) Frame = +2 Query: 2 KTVLANKLRLLASKKGLHPDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYN 181 +TV A+KLRLLAS KGL D +TY L++GYTREG+ KEGE LV EMLDK+FIP +ATYN Sbjct: 290 RTVDADKLRLLASSKGLEADDMTYYTLVNGYTREGKWKEGEVLVDEMLDKEFIPDLATYN 349 Query: 182 RLMAGLAKKSAHQ*QYLLII 241 RLM GL K + Q+ + Sbjct: 350 RLMDGLCKSRSSSTQHFTCV 369 >ref|XP_002308078.1| predicted protein [Populus trichocarpa] gi|222854054|gb|EEE91601.1| predicted protein [Populus trichocarpa] Length = 373 Score = 96.3 bits (238), Expect = 3e-18 Identities = 47/68 (69%), Positives = 57/68 (83%) Frame = +2 Query: 2 KTVLANKLRLLASKKGLHPDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYN 181 +TV NKLRLLAS+KGL D +TY+IL+SG REG+RKEGEALV EMLDK+FIP +ATYN Sbjct: 300 RTVDGNKLRLLASRKGLDVDEMTYDILVSGCIREGKRKEGEALVDEMLDKEFIPDLATYN 359 Query: 182 RLMAGLAK 205 R + GL+K Sbjct: 360 RFIDGLSK 367 >dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis thaliana] Length = 497 Score = 95.1 bits (235), Expect = 7e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +2 Query: 14 ANKLRLLASKKGLHPDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMA 193 AN+LRLLAS KG PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM Sbjct: 422 ANRLRLLASSKGYEPDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMD 481 Query: 194 GLA 202 GL+ Sbjct: 482 GLS 484 >gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|AAT70477.1| At2g36240 [Arabidopsis thaliana] Length = 379 Score = 95.1 bits (235), Expect = 7e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +2 Query: 14 ANKLRLLASKKGLHPDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMA 193 AN+LRLLAS KG PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM Sbjct: 304 ANRLRLLASSKGYEPDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMD 363 Query: 194 GLA 202 GL+ Sbjct: 364 GLS 366 >ref|NP_181166.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206301|sp|Q9SJN2.1|PP187_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g36240 gi|4510352|gb|AAD21441.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330254126|gb|AEC09220.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 497 Score = 95.1 bits (235), Expect = 7e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +2 Query: 14 ANKLRLLASKKGLHPDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMA 193 AN+LRLLAS KG PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM Sbjct: 422 ANRLRLLASSKGYEPDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMD 481 Query: 194 GLA 202 GL+ Sbjct: 482 GLS 484