BLASTX nr result
ID: Angelica22_contig00039446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039446 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308024.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 61 1e-07 ref|XP_002889252.1| pentatricopeptide repeat-containing protein ... 55 5e-06 >ref|XP_002308024.1| predicted protein [Populus trichocarpa] gi|222854000|gb|EEE91547.1| predicted protein [Populus trichocarpa] Length = 789 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = +1 Query: 202 TSISDNILNLISTVNPMEQALEKVVPFLSQDVISSVLEKNTDPCLTFRFFIWA 360 TSISD + +I T+NPME ALE +VPFLS +++S+++ +P L FRFFIWA Sbjct: 30 TSISDEVFTVIKTMNPMEPALEPMVPFLSPKIVTSIIQNPPNPQLGFRFFIWA 82 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 175 HQSRYSTTT-TSISDNILNLISTVNPMEQALEKVVPFLSQDVISSVLEKNTDPCLTFRFF 351 H + ++T +IS+ +L ++ TVNPME ALEK+ PFLS ++++ V+ + P L FRFF Sbjct: 25 HANLFTTAQGAAISNEVLTVMETVNPMEDALEKLAPFLSSEIVNDVMREQRRPELGFRFF 84 Query: 352 IW 357 IW Sbjct: 85 IW 86 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 175 HQSRYSTTT-TSISDNILNLISTVNPMEQALEKVVPFLSQDVISSVLEKNTDPCLTFRFF 351 H + ++T +IS+ +L ++ TVNPME ALEK+ PFLS ++++ V+ + P L FRFF Sbjct: 25 HANLFTTAQGAAISNEVLTVMETVNPMEDALEKLAPFLSSEIVNDVMREQRRPELGFRFF 84 Query: 352 IW 357 IW Sbjct: 85 IW 86 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/78 (38%), Positives = 45/78 (57%) Frame = +1 Query: 127 KSLNHLYIRTNLSFSHHQSRYSTTTTSISDNILNLISTVNPMEQALEKVVPFLSQDVISS 306 +SL R + H YS +IS+ +L +I +VNP+E ALE VPFLS +++ Sbjct: 5 RSLLREISRAKPPWKQHFHTYSAVDFAISNEVLTIIDSVNPIEPALESKVPFLSPSIVTY 64 Query: 307 VLEKNTDPCLTFRFFIWA 360 +++ + L FRFFIWA Sbjct: 65 IIKNPPNSLLGFRFFIWA 82 >ref|XP_002889252.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335093|gb|EFH65511.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 780 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/93 (32%), Positives = 51/93 (54%) Frame = +1 Query: 82 PFLFLQVMKLFLLSPKSLNHLYIRTNLSFSHHQSRYSTTTTSISDNILNLISTVNPMEQA 261 P +F + + F P + Y N F+ IS ++++++ P+E A Sbjct: 3 PQMFFRSVIQFYSKPSWMQRSYSSGNAEFN------------ISGEVISILAKKKPIEPA 50 Query: 262 LEKVVPFLSQDVISSVLEKNTDPCLTFRFFIWA 360 LE +VPFLS+++I+SV+++ + L FRFFIWA Sbjct: 51 LEPLVPFLSKNIITSVIKEEVNRQLGFRFFIWA 83