BLASTX nr result
ID: Angelica22_contig00039422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039422 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADG29115.1| preproricin [Ricinus communis] 56 3e-06 gb|ADG29112.1| preproricin [Ricinus communis] 55 5e-06 gb|AAB22582.1| proricin A chain, partial [Ricinus communis] 55 5e-06 emb|CAA26230.1| unnamed protein product [Ricinus communis] 55 5e-06 gb|ADG29097.1| preproricin [Ricinus communis] 55 6e-06 >gb|ADG29115.1| preproricin [Ricinus communis] Length = 529 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/70 (38%), Positives = 42/70 (60%) Frame = -1 Query: 343 NDKSVPQWEIYPDGTIRPSGIRSNCLARKSSPNDTNVVGIHWCDGGNAERWLFNHDGSIS 164 ++K+ QW +Y DG+IRP R NCLA S+ +T V + + +RW+F +DG+I Sbjct: 459 SEKAEQQWALYADGSIRPQQNRDNCLASDSNIRETVVKILSCGPASSGQRWMFKNDGTIL 518 Query: 163 DATSHYVLEV 134 + S VL+V Sbjct: 519 NLYSGLVLDV 528 >gb|ADG29112.1| preproricin [Ricinus communis] Length = 529 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = -1 Query: 343 NDKSVPQWEIYPDGTIRPSGIRSNCLARKSSPNDTNVVGIHWC-DGGNAERWLFNHDGSI 167 ++K+ QW +Y DG+IRP R NCL S+ +T VV I +C + +RW+F +DG+I Sbjct: 459 SEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRET-VVKILFCGPASSGQRWMFKNDGTI 517 Query: 166 SDATSHYVLEV 134 + S VL+V Sbjct: 518 LNLYSGLVLDV 528 >gb|AAB22582.1| proricin A chain, partial [Ricinus communis] Length = 541 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/72 (36%), Positives = 42/72 (58%) Frame = -1 Query: 343 NDKSVPQWEIYPDGTIRPSGIRSNCLARKSSPNDTNVVGIHWCDGGNAERWLFNHDGSIS 164 ++K+ QW +Y DG+IRP R NCL S+ +T V + + +RW+F +DG+I Sbjct: 445 SEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTIL 504 Query: 163 DATSHYVLEVNK 128 + S VL+V + Sbjct: 505 NLYSGLVLDVRR 516 >emb|CAA26230.1| unnamed protein product [Ricinus communis] Length = 565 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/72 (36%), Positives = 42/72 (58%) Frame = -1 Query: 343 NDKSVPQWEIYPDGTIRPSGIRSNCLARKSSPNDTNVVGIHWCDGGNAERWLFNHDGSIS 164 ++K+ QW +Y DG+IRP R NCL S+ +T V + + +RW+F +DG+I Sbjct: 469 SEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTIL 528 Query: 163 DATSHYVLEVNK 128 + S VL+V + Sbjct: 529 NLYSGLVLDVRR 540 >gb|ADG29097.1| preproricin [Ricinus communis] Length = 529 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/82 (34%), Positives = 45/82 (54%) Frame = -1 Query: 379 SGNDSVKVAPKGNDKSVPQWEIYPDGTIRPSGIRSNCLARKSSPNDTNVVGIHWCDGGNA 200 + + V V ++K+ QW +Y DG+IRP R NCL S+ +T V + + Sbjct: 447 ANSGQVWVEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSG 506 Query: 199 ERWLFNHDGSISDATSHYVLEV 134 +RW+F +DG+I + S VL+V Sbjct: 507 QRWMFKNDGTILNLYSGLVLDV 528