BLASTX nr result
ID: Angelica22_contig00039400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039400 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001185386.1| TIR-NBS-LRR class disease resistance protein... 56 3e-06 gb|AAD55631.1|AC008017_4 Similar to disease resistance proteins ... 56 3e-06 ref|NP_177427.2| TIR-NBS-LRR class disease resistance protein [A... 56 3e-06 gb|ABF81464.1| TIR-NBS-LRR type disease resistance protein [Popu... 55 5e-06 >ref|NP_001185386.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|332197260|gb|AEE35381.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Length = 1183 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = +1 Query: 82 QHWNVFLSFRGVDTLKTFISHLYMEMKHARIRVFLDDDALRMGRTIKSGL 231 +H++VFLSFRGVDT +T +SHLY+ +++ + F DD L +G TI GL Sbjct: 13 RHYDVFLSFRGVDTRQTIVSHLYVALRNNGVLTFKDDRKLEIGDTIADGL 62 >gb|AAD55631.1|AC008017_4 Similar to disease resistance proteins [Arabidopsis thaliana] Length = 1112 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = +1 Query: 82 QHWNVFLSFRGVDTLKTFISHLYMEMKHARIRVFLDDDALRMGRTIKSGL 231 +H++VFLSFRGVDT +T +SHLY+ +++ + F DD L +G TI GL Sbjct: 13 RHYDVFLSFRGVDTRQTIVSHLYVALRNNGVLTFKDDRKLEIGDTIADGL 62 >ref|NP_177427.2| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|110737528|dbj|BAF00706.1| hypothetical protein [Arabidopsis thaliana] gi|332197259|gb|AEE35380.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Length = 1042 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = +1 Query: 82 QHWNVFLSFRGVDTLKTFISHLYMEMKHARIRVFLDDDALRMGRTIKSGL 231 +H++VFLSFRGVDT +T +SHLY+ +++ + F DD L +G TI GL Sbjct: 13 RHYDVFLSFRGVDTRQTIVSHLYVALRNNGVLTFKDDRKLEIGDTIADGL 62 >gb|ABF81464.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Length = 1617 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +1 Query: 88 WNVFLSFRGVDTLKTFISHLYMEMKHARIRVFLDDDALRMGRTI 219 ++VFLSFRG DT K F HLY + HARI F DDD LR G I Sbjct: 256 YDVFLSFRGEDTRKNFTDHLYTALHHARIHAFRDDDELRRGEEI 299