BLASTX nr result
ID: Angelica22_contig00039369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039369 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623537.1| hypothetical protein MTR_7g072140 [Medicago ... 77 1e-12 ref|XP_003623535.1| hypothetical protein MTR_7g072120 [Medicago ... 76 2e-12 gb|AFK46402.1| unknown [Lotus japonicus] 75 4e-12 gb|AFK40426.1| unknown [Lotus japonicus] 75 4e-12 ref|XP_003552292.1| PREDICTED: protein LURP-one-related 15-like ... 74 1e-11 >ref|XP_003623537.1| hypothetical protein MTR_7g072140 [Medicago truncatula] gi|355498552|gb|AES79755.1| hypothetical protein MTR_7g072140 [Medicago truncatula] Length = 215 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = +1 Query: 40 APETVVVGKQYTAPYQVDLTIVRKMMTISGGKFGVTDAEGNIMFKVKGKVMSLRARRVL 216 A T + G+QY APY VDL +V+K+MTIS G F VTD GNI+FKVKG +++LR RRVL Sbjct: 18 AHPTAIFGQQYCAPYPVDLAVVKKVMTISDGNFAVTDVNGNIVFKVKGSLLTLRDRRVL 76 >ref|XP_003623535.1| hypothetical protein MTR_7g072120 [Medicago truncatula] gi|355498550|gb|AES79753.1| hypothetical protein MTR_7g072120 [Medicago truncatula] gi|388494416|gb|AFK35274.1| unknown [Medicago truncatula] Length = 212 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/58 (60%), Positives = 43/58 (74%) Frame = +1 Query: 43 PETVVVGKQYTAPYQVDLTIVRKMMTISGGKFGVTDAEGNIMFKVKGKVMSLRARRVL 216 P + G QY APY VDL +V+K+MTIS G F VTD GNI+FKVKG +++LR RRVL Sbjct: 19 PTAAIFGPQYCAPYPVDLAVVKKVMTISDGNFAVTDVNGNIVFKVKGSLLTLRDRRVL 76 >gb|AFK46402.1| unknown [Lotus japonicus] Length = 216 Score = 75.5 bits (184), Expect = 4e-12 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = +1 Query: 40 APETVVVGKQYTAPYQVDLTIVRKMMTISGGKFGVTDAEGNIMFKVKGKVMSLRARRVL 216 A T V G QY APY VDL IV+K+MTIS G F VTD GNI+FKVKG +++LR RRVL Sbjct: 21 AVPTTVFGPQYCAPYPVDLAIVKKVMTISDGNFVVTDINGNIVFKVKGSLLTLRDRRVL 79 >gb|AFK40426.1| unknown [Lotus japonicus] Length = 214 Score = 75.5 bits (184), Expect = 4e-12 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = +1 Query: 40 APETVVVGKQYTAPYQVDLTIVRKMMTISGGKFGVTDAEGNIMFKVKGKVMSLRARRVL 216 A T V G QY APY VDL IV+K+MTIS G F VTD GNI+FKVKG +++LR RRVL Sbjct: 21 AVPTTVFGPQYCAPYPVDLAIVKKVMTISDGNFVVTDINGNIVFKVKGSLLTLRDRRVL 79 >ref|XP_003552292.1| PREDICTED: protein LURP-one-related 15-like [Glycine max] Length = 216 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = +1 Query: 40 APETVVVGKQYTAPYQVDLTIVRKMMTISGGKFGVTDAEGNIMFKVKGKVMSLRARRVL 216 A T V+G Q+ APY +DL +V+K+MT+S G F VTD GN++FKVKG +M+LR RR+L Sbjct: 21 AVPTAVIGPQFCAPYPLDLAVVKKVMTLSDGNFVVTDVNGNVVFKVKGSLMTLRDRRIL 79